KEGG   Clostridium cellulolyticum: Ccel_1002Help
Entry
Ccel_1002         CDS       T00835                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cce  Clostridium cellulolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ccel_1002
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ccel_1002
   00600 Sphingolipid metabolism
    Ccel_1002
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ccel_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1244410..1245879
Genome map
AA seq 489 aa AA seqDB search
MSFKVAFIGAGSLVFTRTLFTDIMSVPEFRDIKIAFTDINGDNLQKVAELCQRDLEANGI
TTKIQATTDRREAFKDAKYIVNCVRIGGLEAFETDIDIPLKYGVDQCVGDTLCTGGIMYG
QRVIAAMLDFCKDIREVSAPGAILLNYSNPNAMATWACNKYGGVRTIGLCHGEIHGEDQI
AQVLGIPRNELDIICAGINHQTWYISVKHKGKELLDKILPGFEAHPKFSEEEKVRIDVLK
RFGYYSTESNGHLSEYVAWYRKRPQEIMKWINLDSWINGETGGYLRITREERNWFETDYP
KILAEPPKKYDGSSRGREHCSYIIESLETGRKYRGHFNVMNEGCITNLPYESVVEVPCYV
DGNGISVPKVGDLPLGCAAVCSQSIWVQRLAVEAAVSGNVTLLKQAALMDPLTGAVCNPP
EIWQMIDEMLIAQEKWLPQYVEGIKAAKERFAKGNLIPINEGYRGAVRQRVKTPSEVAAE
RESRSITAD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaagttgcttttataggagcgggaagtcttgtgtttacgagaacactgttt
acagacataatgtcggttcctgaattcagggatattaaaattgcatttaccgacattaac
ggagataatcttcaaaaggtggcggaattgtgccagagagatcttgaggccaatggtatc
actactaaaatccaggctaccactgacaggcgggaggctttcaaggatgcaaaatatatt
gtgaattgtgttcgtataggaggcctggaagcttttgaaacagatatagacataccgtta
aaatacggtgttgaccaatgtgtgggagatactctctgtacaggtgggattatgtatgga
cagcgtgttatagccgcaatgttggatttttgtaaagacataagagaagtttcggcaccc
ggagcaattctgctgaactactcaaatcctaatgctatggcaacctgggcctgcaacaag
tacggtggagttcgcaccatagggctttgccacggtgaaattcatggcgaggatcagatt
gcccaggtgctgggaataccaagaaacgaacttgacatcatctgtgctggtataaaccac
caaacgtggtatatttcagtaaaacacaagggaaaagagctgttggacaaaatacttccc
ggatttgaggcacaccccaagttcagcgaggaagaaaaggtcagaattgatgtactaaag
cgctttggttactattccacagaatcaaacggtcatctttcggaatacgtggcatggtac
cgtaagagaccccaggaaataatgaaatggataaaccttgatagctggattaacggtgaa
acaggcggctatttgagaattacaagggaagaacgaaactggtttgagactgattaccca
aagatacttgctgaacctccaaaaaaatatgacggttcgtccagagggagggaacattgt
tcctacataatcgagtctttggaaacaggaagaaaatacagaggacattttaatgtaatg
aatgaaggctgtattacgaaccttccgtatgagtcggtggttgaagttccctgttacgtg
gacggcaacggtatatctgtcccgaaggtaggagatttgccactgggctgtgccgcagtt
tgttcacaatccatatgggtacagcggcttgctgttgaggcggcggtatcagggaatgta
actctgctgaaacaggcagctttgatggacccactcaccggagccgtttgcaatccgccg
gaaatatggcaaatgattgacgaaatgctaatagctcaggaaaagtggcttcctcagtat
gttgaaggtatcaaagctgcaaaagagagatttgccaagggaaaccttattcctataaat
gaaggatatcgtggtgcagtaagacaaagggtcaaaactccttccgaggtagctgccgaa
cgtgaatccagaagtattacagctgattaa

DBGET integrated database retrieval system