KEGG   Clostridium cellulolyticum: Ccel_1031Help
Entry
Ccel_1031         CDS       T00835                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ccel_1031
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ccel_1031
Exosome [BR:cce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccel_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1283266..1284771
Genome map
AA seq 501 aa AA seqDB search
MSKKYILAIDQGTTSTKVLVVNHDSKIIDRASKDITQFYPQSGWVEHDADEIWETVMDCC
NEIFARNIVKPEEIAAIGITDQRESTILWDRDSGRPVYNAICWQSRQTASICERMKKQEG
LEELINEKTGLRIDPYFSASKIKFILENVPGVQERVNEGKILMGTIDSWIMWNLSGKKSH
VIDYTNASRTLLLNIHTLQWDDELIEKIGVPKQILPELKPSSCDALAFTAPDVFFGQQIP
ISGDAGDQHAATIGQACFEPGMAKNTYGTSMALFMNIGDKPLKSNYGLTTDLGWVIDGKV
QYAFEGVVFVGGAVVQWLRDGLGIIKNARECDILAEKVQDTGGVYIVPAFAGMCAPYWDA
YARGTIIGLTRGTTKEHICRAALESMGYQTRDVIDAMVADTGKELKSLRVDGGATKSEFL
LQFQADILGIPVELPEITDMAALGAAYLAGLGIGFWKDVSELRQHWKIKKVYYPRMSKEE
RDSLYEGWKKAVGRSLDWAEK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaatatattctggctattgatcagggaacaacatctactaaagtattagta
gtaaatcacgacagtaaaattattgaccgggcttccaaggatataacacagttttatcca
cagtctggttgggttgagcatgatgcagatgaaatttgggaaacagtaatggactgctgt
aatgaaattttcgctagaaatattgtaaaacctgaggaaattgctgcaatcgggattacc
gaccaacgggagtccacaatattgtgggatcgtgattccggtagacctgtatataatgca
atatgttggcaaagcaggcagacagcatccatttgcgaaagaatgaagaagcaggaagga
cttgaagaattaattaatgaaaaaacgggacttcgtattgacccttacttttcagcaagt
aaaataaagtttattctggagaatgtccccggtgttcaggaacgagtaaatgaaggaaag
atattgatgggaaccattgattcctggattatgtggaacctaagtggtaaaaaatcccat
gtaattgattatacaaatgcttctcgtacattacttcttaatattcatactttgcaatgg
gatgatgaacttattgaaaaaataggagtgccaaaacagattctccctgaattaaaacca
tcatcatgcgatgctcttgcattcacagccccggatgtattttttggtcaacaaatccca
atatccggagatgcaggggatcaacatgctgcaactataggacaggcctgctttgagccg
gggatggctaaaaatacgtatggaacatcaatggctttatttatgaacatcggtgacaag
ccattaaaatcaaactacggtcttactacagatttgggatgggtaattgacggtaaggtt
cagtatgcttttgaaggagtcgtatttgtaggcggtgcagttgttcagtggcttcgagat
ggtttgggtattataaaaaatgcaagggaatgtgatattctggctgaaaaagtacaggat
accggaggcgtatatattgttccggcatttgcaggaatgtgtgcaccatactgggatgct
tatgcgaggggtactatcattggacttaccagaggtactaccaaagaacatatttgccgt
gcagcacttgaatcaatgggataccagaccagagatgtaattgatgcaatggttgctgat
actggtaaagaactaaaatccttgagagttgatgggggagcaacaaaaagcgaatttttg
cttcagtttcaggctgatatactgggaattccggttgaattacctgaaattacagatatg
gcggcattaggtgcagcttatcttgccggacttggtataggattctggaaggatgtttct
gaattaaggcagcattggaagattaaaaaggtttactatccaagaatgagtaaggaagaa
cgtgatagtttgtatgaaggatggaagaaggctgttggacgctctttggattgggctgaa
aaataa

DBGET integrated database retrieval system