KEGG   Clostridium cellulolyticum: Ccel_1084Help
Entry
Ccel_1084         CDS       T00835                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_1084
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_1084
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_1084
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1338447..1339169
Genome map
AA seq 240 aa AA seqDB search
MKLICYLSNGYPTIESSIEIAKDYIDAGCDIIEVDFPSSDPYLEGEYIANRMRDALTVCN
DYDKYMDGIIEIKNSHPNTKFILLSYENTILEIGVDRFVKFCVDNDIMDLIYVGKDNREV
KSKLIDNGIKISCYVQFHMDENEIRAAVESNGFVYMQAKPTTNNINPKFPTLKHCIDHLK
GLGIKREIYCGVGIYAPEDIKMAKEAGADGVFVGSTVLKLQTDIPKMKETIALLKKTCNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactaatatgttatttatccaacggatacccaacaatagagtcaagcatagagatt
gctaaggactatattgacgcaggctgtgatataatcgaggtggattttccttcctctgac
ccataccttgaaggggagtatatcgcaaatagaatgagagatgcccttacagtctgcaat
gattatgacaagtatatggacggaattattgagataaagaatagtcatcctaataccaaa
tttatactattgtcatatgaaaatacaattcttgaaataggtgttgaccgttttgtaaaa
ttctgcgttgacaatgatataatggaccttatctatgtaggaaaagacaatcgggaagta
aaaagcaagctgattgacaacggtataaagatatcctgctacgttcaatttcacatggat
gaaaatgaaatacgggcagcagttgagtcaaacggatttgtttatatgcaggctaagcct
actaccaataacattaatccaaaatttccaactctcaagcactgcatagatcacttgaag
ggccttggaataaaaagggagatatactgcggtgtaggtatatacgcacccgaagatata
aaaatggctaaggaagccggagctgacggtgtttttgtgggaagtactgtattgaagctt
caaacagacataccaaagatgaaagaaacaattgctttattaaaaaagacttgcaacgag
taa

DBGET integrated database retrieval system