KEGG   Clostridium cellulolyticum: Ccel_1237Help
Entry
Ccel_1237         CDS       T00835                                 

Definition
family 6 carbohydrate binding protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cce  Clostridium cellulolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ccel_1237
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ccel_1237
   00600 Sphingolipid metabolism
    Ccel_1237
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ccel_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1520816..1522630
Genome map
AA seq 604 aa AA seqDB search
MKKVRTVSTIIFLGLMITVIMVLNTGAWDNGLAKTPPMGWNSWNIFHGDINETKIKQIAD
TMVSSGMKEAGYVYLNLDDNWMANPARDSNGNLRADPTRFPSGIRALADYVHAKGLKLGI
YGCRGTMTCMNIPQSGSKGYEDKDAKTFASWGIDYLKYDNCNIPNGSDMKTDYQKMQTAL
ANCGRPIVFSICAWGYQSWMPATGNLWRTTGDIADKWDNGNEWFKGIINAIDGNAQYTSS
AAPGAWNDPDMLEIGNGGCTTEEYRTQMSMWSMMASPLIAGNDIRTMSQTTKDILLNKEV
IAIDQDPAGVQGKRVKSANGLEIWVKPLGTNGTTKAVALLNRNSATSNITVNWSDIGVSG
SVTVRDLWAKSDKGSFTGSYTASVPSHGTVLIKISTEPPAPVDATKQIEAESYSNQSGIQ
TETCSEGGEDVGFIENGDYTVYSNVDFGDGVGGFQARVASATSGGNIEIRLDSPAGTLIG
TCPVAGTGDWQTYTDVKCTVSGATGKHDVYLVFKGDSGYLFNLNWFTFTPGSVNTGTLGD
LNSDGQVDAIDLQLLKKYILGLGAIENTKLADLDANGDINAIDFSLLKQFLLGIRTSFPG
QGAA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttcgtacagtcagtacaattatctttttaggacttatgattaccgtaatt
atggttttgaatactggtgcatgggataacggtcttgcaaaaacaccaccgatgggatgg
aacagttggaacatattccatggagacattaatgaaactaaaatcaaacagattgctgat
accatggtaagctcgggtatgaaggaagctggctatgtatacctgaatctggatgataac
tggatggcaaatcctgcaagagattccaatgggaacttgcgggccgatcctacacgattc
ccaagtgggattagggctttagctgattatgtacatgcaaaaggtctcaaactagggata
tacggatgtcgtggaacaatgacctgtatgaatattcctcaaagcggaagcaagggttat
gaggacaaggatgcaaagacatttgcttcatggggaattgattaccttaaatatgataac
tgcaatatacctaacggaagtgacatgaaaaccgattaccagaaaatgcagaccgctctt
gcaaattgcggaagaccaatagtattcagtatatgtgcatggggatatcagagctggatg
cctgcaacaggtaatttatggcgtactaccggggatatcgctgataagtgggataacgga
aacgaatggttcaaaggtattataaatgcaattgatggtaatgcacaatacacaagttca
gccgcacccggtgcatggaatgatcctgatatgcttgaaatcggaaacggtggatgtaca
acagaggaataccgtacacagatgagtatgtggagtatgatggcttctccccttattgca
ggaaatgatataaggaccatgtcacagacaacaaaggatattctattgaataaggaagta
atagcaatagaccaggatcctgcaggagttcagggaaaaagagttaaaagtgcaaatggt
cttgagatttgggtaaaaccactgggtacgaatggtacaactaaggcagttgctttattg
aacaggaattcggcaacatccaatattacagttaattggtcagatataggtgtaagtgga
agtgttacggtcagggatttgtgggctaaatctgacaaaggcagttttacgggctcatac
acagcgtctgttccttcacatggaactgttttgattaagatttccactgagccgccggca
cctgttgatgcaacaaagcaaatagaagcagagagttatagcaatcagtcaggaatccag
acagaaacctgttcggaaggcggagaggatgtaggctttatcgaaaacggggactatact
gtttacagcaatgtggatttcggtgatggagtcggaggcttccaggcaagagtagcaagt
gcgaccagcggaggcaatattgagattagacttgacagccctgccgggactttaattgga
acctgtccggttgccggaacaggggattggcagacttatactgatgtaaaatgtactgtc
agcggggcaacaggaaaacatgatgtataccttgtatttaaaggagatagcggatattta
ttcaaccttaattggttcacatttactccaggaagtgtcaatacgggtacattgggtgat
ttaaattccgacggacaagtagacgcgatagatttacagttattgaaaaagtatatttta
ggactgggagcaatcgaaaatacaaaactggcagatttggatgccaacggagatatcaat
gcaatagatttttcactgctgaaacaattcttactaggcataaggaccagctttccgggg
cagggggcagcataa

DBGET integrated database retrieval system