KEGG   Clostridium cellulolyticum: Ccel_1246Help
Entry
Ccel_1246         CDS       T00835                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cce  Clostridium cellulolyticum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ccel_1246
   00500 Starch and sucrose metabolism
    Ccel_1246
Enzymes [BR:cce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Ccel_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1540543..1542225
Genome map
AA seq 560 aa AA seqDB search
MKRERFFQLALIFVFVFQTIVGSFLMSKVGAVSYDLIVAKDGSGNYTTVQAAINSAPSNS
QTRTKIYIKNGTYKEKINISSSKINISLIGQSKAGTILTYNDAASTKTSSGGTLGTTGSA
SVTIAGNGFQAENITFENSYDEKAYGNSQAVAVLAKADKMIFKGCSFKGNQDTLYANGDA
RRQYYYNCYIEGDVDFIFGSANAVFDSCEIFSLNRSGGCITAPSTKANQKGYLIYKCKLT
SSSSPKTIYLGRPWIPSSDTVQTTPKVLYRECELGSHITDTGWTVMSGNDPANFEMWEYN
NTGTGANTYRKQLPSVKAADYTIEKFLSGSDGWNPNIDSNTPVPIPDGQYIKSLVINDTV
NAVNWSVQSNLQVGDIIYGDRTYKFTQVPQKLLGSEWIKTACNSKIYTSDLASFTAKSDV
TVYIGLDTRVTSIPGWLSSWTDTGESLVSDNSSVAYNIYKKDFMAYSLVTLGTNGASSST
VNYAVIVKSNTYDFLLGDANGDGEVNSLDYATLKSYLLGKISLSQEAMKTVDFNNDNTID
AIDLALFRINLLGGPIYNML
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagggaaagattttttcagctagctttgatttttgtctttgtgtttcaaaccata
gttggctcatttttaatgtctaaagtgggagcggtgtcctatgatttgattgtagcaaag
gacggaagcggtaattatactacggtacaggcagctataaacagtgcaccttccaatagc
caaaccagaacaaaaatatacattaaaaacggaacatataaagaaaaaataaatatttcg
tcgtctaaaataaatatttcattgattggacaaagtaaggcaggcacgattttaacctat
aatgatgcagcgagtacaaaaacatcttcgggcggaacattaggtacgacgggaagtgcc
agtgttaccattgcaggtaatggttttcaggcggaaaacattacttttgaaaattcatat
gatgaaaaagcttatggcaacagtcaggctgtagctgttcttgctaaagcagacaaaatg
atatttaaaggctgttcattcaagggtaatcaggatacactatatgcaaacggagatgct
cgcaggcaatactactataactgctatattgagggagatgtggatttcatttttggatct
gcaaatgcggtatttgatagttgtgaaattttttctctcaacagaagcggagggtgtata
acggcacccagcaccaaggcaaatcaaaagggatatcttatatacaagtgcaagctgaca
agtagctcaagtcccaaaactatttatctaggaagaccctggattcccagttccgatact
gttcagacaacgccaaaggtattatatagggagtgtgaactaggctctcatattactgat
acaggttggactgtcatgtcgggcaatgatcctgcaaattttgaaatgtgggaatataat
aatacaggcacaggtgcgaatacatatagaaagcagcttccgtcagtgaaggcagccgat
tacacaatagagaaatttctttcagggtctgacggttggaatccgaatatagatagtaat
actcctgtaccgattcctgacgggcaatacataaagtcactggttataaacgataccgta
aatgccgtaaactggtctgttcagtcaaatttacaagtcggagacataatttacggtgat
aggacatataaattcacacaggttccacaaaagcttctgggttcagagtggataaagaca
gcatgtaattccaaaatttatacatctgacttggcgtcttttactgcaaaatcggatgta
actgtttatattggcctggacaccagagtaacaagtattcccggctggctgagcagctgg
actgatacgggtgaatcattagtaagtgataatagttcagttgcgtacaacatatacaaa
aaggatttcatggcatattctcttgtaacacttggcaccaacggtgcatcctcaagtact
gtcaactacgcggttattgttaagtcaaatacgtatgatttccttttaggtgatgcaaat
ggtgatggggaggtaaactctcttgattatgccactcttaagtcatatctactgggaaag
ataagtttatcgcaggaagccatgaagacggtagattttaataatgataatacaatagat
gctattgatttggctttgttcagaataaatcttttaggcgggcctatatataacatgctg
taa

DBGET integrated database retrieval system