KEGG   Clostridium cellulolyticum: Ccel_1279Help
Entry
Ccel_1279         CDS       T00835                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cce  Clostridium cellulolyticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccel_1279
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ccel_1279
Exosome [BR:cce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccel_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1583304..1584281
Genome map
AA seq 325 aa AA seqDB search
MINRPRRLRTGEVLRKAVRETRLSTDSLIQTLFIIEGNNIKKEISSLPGQYHYSPDMVGE
AIENALNADVKSVLLFGLPEHKDEKGSEAYNENGVLQQGIREIKQRYPQMQVITDICMCE
YTSHGHCGILEGERVDNDRTLPYLEKIALSHARAGADIVAPSDMMDGRINALRTALDKNG
FTDIPVMSYAVKYASSFYGPFREAAGSAPAFGDRKSYQMDYHNRREAVKEALLDVEEGTD
ILMVKPALAYLDVIKEVREKTQLPLAAYSVSGEYAMIKAAAAQGLIDEYGVMCESAVSIF
RAGADMLITYFAKEISQAIKKGDIG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgattaacagaccaagaagattgagaacaggtgaagtgctgcgaaaagcagtcagggaa
accagactgtcaactgattcacttattcagactcttttcataatagagggtaataatata
aagaaggaaatcagttccctgcccggacagtaccattatagccccgatatggtgggggaa
gcaattgaaaatgcgcttaatgcagatgtaaaatccgtactgctctttggactcccggag
cataaggacgaaaaaggttctgaggcatacaatgaaaacggtgtactacagcagggaata
cgtgaaataaagcagaggtatccacagatgcaggtaataacggatatttgcatgtgtgaa
tacacatctcacgggcactgcggaattttggagggtgaaagggtagataatgacagaacc
ctgccctatctggaaaagatagctttgtcccatgcaagggcaggagcggatatagtagct
ccgtcggatatgatggacggcagaataaatgccctgaggacggctctggataaaaatgga
tttacagacattcctgtcatgtcatatgctgtaaagtatgcctcgtcattttatggtccc
ttccgtgaggcagcaggctctgcgcctgcattcggagaccgtaaaagctaccagatggat
tatcataacagacgtgaagctgtaaaggaagcacttcttgatgttgaggaaggcacggat
atattgatggttaagcctgcactggcttatctggatgttataaaggaggtcagggaaaaa
actcagcttcctctggcagcctacagtgtcagcggtgaatatgccatgataaaggctgcc
gccgctcagggactgattgatgaatacggtgtaatgtgtgaaagtgcagtcagcattttc
agagcaggagcagatatgcttataacttattttgcaaaagagatttcccaagcaattaag
aaaggggatataggatga

DBGET integrated database retrieval system