KEGG   Clostridium cellulolyticum: Ccel_1290Help
Entry
Ccel_1290         CDS       T00835                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cce  Clostridium cellulolyticum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ccel_1290
Enzymes [BR:cce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ccel_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1595192..1595989
Genome map
AA seq 265 aa AA seqDB search
MVEKNNSKYLTDDEAARAIVEIGKRMYLKGFVASNDGNISIKTGENEILTTPTGVSKGYM
TKEMLVKVDLNGEIISGNTKPSSELKMHLRVYSENPDVMAVTHAHPPVATSFAIAGIELD
RAILPEAIVNLGTVPIAPYATPGSQAVPDSIAPFCREYNAVLLANHGAVTWGKDVFEAYH
RLESLEYYATVLMYTGNIIGKANELSSKQISQLVEIRRKLGINTGGTPKVKDLEYNTTDN
SQDEFLIRDIVEQVTKIVLEKYKSK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaaaaacaactccaaatatcttactgatgatgaagccgcacgtgccatagtt
gaaataggaaagagaatgtatttaaaaggctttgtggcttctaatgacggtaatataagc
attaagacaggtgaaaatgaaatattgacaactccaacaggtgtttccaagggatatatg
acaaaggaaatgctggtgaaagttgacttgaacggcgaaatcatatctggaaacacaaaa
ccctcatcagaattgaaaatgcacctgcgtgtatatagtgaaaatcctgatgttatggct
gtaacacatgcacatcctccggtagccacttcctttgccattgcgggaattgagcttgac
agggctatactgcctgaagcaattgttaatctcggaactgtaccaatagctccctatgcc
actccgggcagtcaggctgttcccgactcaatagcacccttttgccgggagtacaatgca
gtacttcttgcaaaccatggagctgtaacgtggggcaaggatgtattcgaagcataccac
cgccttgagtcgctggagtactatgccacggtattaatgtacaccggaaatataatcgga
aaagccaatgaacttagttctaagcagatttcccaactggttgaaattcgccggaagctt
ggaattaatacaggcggaacgccaaaagtaaaggatttggaatacaatacaactgataat
tcacaggacgaatttttaatccgtgatatagttgagcaggttacaaaaattgtgctagag
aagtataaaagtaaatga

DBGET integrated database retrieval system