KEGG   Clostridium cellulolyticum: Ccel_1290Help
Entry
Ccel_1290         CDS       T00835                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00051  Fructose and mannose metabolism
cce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ccel_1290
Enzymes [BR:cce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ccel_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACL75646
JGI: Ccel1290
UniProt: B8I0S1
Position
1595192..1595989
Genome map
AA seq 265 aa AA seqDB search
MVEKNNSKYLTDDEAARAIVEIGKRMYLKGFVASNDGNISIKTGENEILTTPTGVSKGYM
TKEMLVKVDLNGEIISGNTKPSSELKMHLRVYSENPDVMAVTHAHPPVATSFAIAGIELD
RAILPEAIVNLGTVPIAPYATPGSQAVPDSIAPFCREYNAVLLANHGAVTWGKDVFEAYH
RLESLEYYATVLMYTGNIIGKANELSSKQISQLVEIRRKLGINTGGTPKVKDLEYNTTDN
SQDEFLIRDIVEQVTKIVLEKYKSK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaaaaacaactccaaatatcttactgatgatgaagccgcacgtgccatagtt
gaaataggaaagagaatgtatttaaaaggctttgtggcttctaatgacggtaatataagc
attaagacaggtgaaaatgaaatattgacaactccaacaggtgtttccaagggatatatg
acaaaggaaatgctggtgaaagttgacttgaacggcgaaatcatatctggaaacacaaaa
ccctcatcagaattgaaaatgcacctgcgtgtatatagtgaaaatcctgatgttatggct
gtaacacatgcacatcctccggtagccacttcctttgccattgcgggaattgagcttgac
agggctatactgcctgaagcaattgttaatctcggaactgtaccaatagctccctatgcc
actccgggcagtcaggctgttcccgactcaatagcacccttttgccgggagtacaatgca
gtacttcttgcaaaccatggagctgtaacgtggggcaaggatgtattcgaagcataccac
cgccttgagtcgctggagtactatgccacggtattaatgtacaccggaaatataatcgga
aaagccaatgaacttagttctaagcagatttcccaactggttgaaattcgccggaagctt
ggaattaatacaggcggaacgccaaaagtaaaggatttggaatacaatacaactgataat
tcacaggacgaatttttaatccgtgatatagttgagcaggttacaaaaattgtgctagag
aagtataaaagtaaatga

DBGET integrated database retrieval system