KEGG   Clostridium cellulolyticum: Ccel_1328Help
Entry
Ccel_1328         CDS       T00835                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cce  Clostridium cellulolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccel_1328 (folE)
Enzymes [BR:cce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ccel_1328 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1629265..1629852
Genome map
AA seq 195 aa AA seqDB search
MSIDRKKVEEHIRGLLVAIGENPDREGLKETPSRVAQMYQEVFEGISYTNDEIAEMFNKT
FEEDLVIPKDNKEIVLVKDIDIFSYCEHHMALMYNMKVAVAYIPNDKILGLSKIARIADM
VGKRLQLQERIGSDIAEIMQKITDSEDVAVIVEGQHACMTTRGIKNTGSRTTTTTLRGAF
KTDTNLTNRLMMLYK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagataggaaaaaagttgaggagcatatcagaggcttactggttgctatcgga
gagaaccctgacagggaagggctgaaggagactccttcacgagtcgcccagatgtatcag
gaagtttttgagggtatcagctatacaaatgacgagattgctgaaatgtttaacaagaca
tttgaagaagatttggtgataccaaaagataacaaagaaatagtattggttaaggatata
gatattttcagctattgtgagcatcatatggcacttatgtacaatatgaaagttgcagtt
gcctacatacctaacgataaaatacttggcctgagtaaaatagccagaattgccgatatg
gtcggaaaacgtcttcagcttcaggaaaggatagggtcagatatagccgaaattatgcaa
aagataaccgattcagaagatgttgccgtaattgttgaagggcagcacgcatgtatgaca
accaggggtatcaaaaacacaggctctcggactacaaccactacccttaggggagctttt
aaaaccgatacaaatcttacaaacagattaatgatgttatataagtaa

DBGET integrated database retrieval system