KEGG   Clostridium cellulolyticum: Ccel_1332Help
Entry
Ccel_1332         CDS       T00835                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cce  Clostridium cellulolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccel_1332
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ccel_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1631558..1632031
Genome map
AA seq 157 aa AA seqDB search
MCNSEVTAYIGLGSNIGDRKFQLNRAVELLKGAEKVEVTAVSSYYNTAPVGYEQQPDFLN
AVVEIRTALSAYGLLQLCSEIEKELKRERIIRWGPRTIDLDILLFGNEIIYKKDLVIPHP
RMHERRFVLEPLNEIAPEVLHPVFNKYIREIFHSSFM
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaatagtgaagttactgcatatatagggttgggttcaaatataggtgacaggaaa
tttcaacttaaccgggcagtggagctgctaaaaggggctgaaaaagttgaagttacggct
gtgtcctcttattataataccgctccggtggggtacgaacagcagcctgattttttgaat
gcagtggttgaaatcaggacagccttgtctgcctatgggcttttacagttgtgttcggaa
atagaaaaggaacttaagagggaaagaataatacgctgggggccaaggactatcgatctt
gatattctgcttttcggcaatgaaatcatatataaaaaggatttggtaattcctcacccg
aggatgcatgaacggaggtttgtactggagcctttaaatgaaattgccccggaggtattg
catcctgtttttaacaaatatatacgagaaatatttcatagtagttttatgtaa

DBGET integrated database retrieval system