KEGG   Clostridium cellulolyticum: Ccel_1347Help
Entry
Ccel_1347         CDS       T00835                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cce  Clostridium cellulolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ccel_1347 (ruvA)
Enzymes [BR:cce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ccel_1347 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1645499..1646098
Genome map
AA seq 199 aa AA seqDB search
MFAYIKGTVEEKNNDSIIVEAGGIGYRIFTALSTINNMGQNGTTVKIYTHYYVREDIAVL
YGFGTVEELTMFEMLLTVSGVGPKAAISMISTLSPSRFYLAVVSQDTKSLTKAPGIGMKM
AQRIILDLKDKISKEQLTSSIPMTSPENNEVTGDSVLSEAVSALMVLGYGSAEASSTISG
IYEKGISVEELVKKALKSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatacataaaaggaacagttgaagaaaaaaacaatgacagtattatagtagaa
gccggaggaatcggatacaggatatttaccgcactttccacaataaataatatgggacag
aatggtacaactgtaaagatttatactcattactacgtcagggaggatattgcagtcctc
tacggctttggtacagttgaagaacttactatgtttgaaatgcttctgacggtttcaggg
gttggcccgaaggctgcaatatccatgatttcaacgctttcgccctcaaggttttatttg
gctgttgtctcacaggatacaaaatcactgacaaaagctccgggtataggaatgaaaatg
gctcagcgtattatcctagacctaaaggacaaaatatcaaaggaacagctgacatcttca
attccgatgactagtcccgaaaacaacgaggttaccggggattctgtcctgtcagaggct
gtgagtgcattgatggttctgggatacggttcagcggaagcgtcaagcaccataagcggt
atttacgaaaaaggaattagcgtggaagaattagttaagaaagcacttaagtcgctttag

DBGET integrated database retrieval system