KEGG   Clostridium cellulolyticum: Ccel_1450Help
Entry
Ccel_1450         CDS       T00835                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_1450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_1450
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ccel_1450
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ccel_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1762064..1763587
Genome map
AA seq 507 aa AA seqDB search
MLYRSTRGSCRSVSAAEAIKRGIAADGGLFVPEKTVQFNLEQIALMSEMSYQERAVKILE
GYLDDYTNEELLECVNKAYTAEKFETNDIAPLHKLYDSVNILELWHGPTSAFKDMALQIL
PHFLVKALKKTGEKEEIVILVATSGDTGKAALEGFKDVIGTKIIVFFPSEGVSQVQKMQM
VTQEGSNVYAIAVDGNFDDAQNGVKRIFGDEDVTALMEEHGYKFSSANSINWGRLVPQIV
YYFSAYADMIKNGEIKAGEKINFVVPTGNFGNILAAYYAMQMGLPVNKLICASNDNNVLT
DFINTGEYNKNREFKKTLSPSMDILISSNLERLLYLITGDNAEKVCEWMNQLKNVGSYSV
DQDTKKKIQSIFWAGYTNDSDTLKTIESVYQETGYVLDTHTAVAVDVYDKYVISTSDVTK
AVIVSTASPFKFNDSVLKAIAGEEAIKGKTEFELLSVLSEKSGLKIPAPLKELDKKPVLH
KEFCEPINMIGKVKEALKIQENIKTAK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagaagcacaagaggaagctgcagaagtgtgagtgcagctgaagctataaaa
agaggtattgcagcagacggaggtctgtttgtacctgaaaagacagttcagtttaatcta
gaacaaatagctctcatgagtgaaatgagttatcaggaaagagcagttaagatacttgaa
ggatatttggacgattatactaatgaagaactattggagtgcgtaaacaaggcttataca
gcagagaaatttgaaactaatgatattgcccctttgcataagctttatgattcggtaaat
attttggaactttggcatgggcctacaagtgcatttaaagatatggctcttcagatactt
ccgcattttcttgttaaggcacttaaaaagacaggagaaaaagaagaaatagttatattg
gttgcgacatcaggagataccggaaaagctgctcttgaagggtttaaggatgtaattggg
acaaaaattattgtatttttcccaagtgaaggtgtcagtcaggtacagaaaatgcagatg
gtaactcaggaaggtagcaatgtatacgctattgcagtagatggtaactttgatgatgct
caaaacggagttaaaagaatattcggtgatgaggatgtaactgctttaatggaagaacat
ggatacaagttttcatcagcaaactctataaactggggaaggctagttccacaaatcgtt
tattatttttcagcatatgctgatatgataaagaatggcgaaattaaagcaggagaaaag
ataaattttgttgttcctacaggtaattttggtaatattctggctgcttactatgctatg
cagatgggtttgcctgttaacaagcttatttgtgcttcaaatgacaacaatgtgctgacc
gactttattaatacaggagaatacaataaaaacagagaattcaaaaagactttatctcct
tctatggatattcttatatcaagcaatctggaaagactattatacctgataacaggtgac
aatgctgaaaaggtttgtgaatggatgaaccagcttaaaaatgtcggttcatacagcgta
gatcaagacaccaaaaagaaaatccagagtattttctgggcaggatataccaatgatagt
gacactttaaaaactattgagagtgtttaccaggagacaggatatgtattagatacgcat
actgctgttgcagtggacgtgtacgacaaatatgttatttctacaagtgatgttacaaaa
gctgttattgtttctactgcaagtcctttcaagtttaacgatagtgttttaaaggctata
gcaggagaagaggctattaaaggaaagactgaatttgagcttctgtctgtactatcggaa
aagtcaggacttaaaattcctgctccgttgaaggaattggataaaaaacctgttctacac
aaggaattttgtgagccgataaatatgatcggtaaggttaaggaagcattaaaaatccaa
gaaaatattaagacagcaaaataa

DBGET integrated database retrieval system