KEGG   Clostridium cellulolyticum: Ccel_1450Help
Entry
Ccel_1450         CDS       T00835                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_1450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_1450
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ccel_1450
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ccel_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1762064..1763587
Genome map
AA seq 507 aa AA seqDB search
MLYRSTRGSCRSVSAAEAIKRGIAADGGLFVPEKTVQFNLEQIALMSEMSYQERAVKILE
GYLDDYTNEELLECVNKAYTAEKFETNDIAPLHKLYDSVNILELWHGPTSAFKDMALQIL
PHFLVKALKKTGEKEEIVILVATSGDTGKAALEGFKDVIGTKIIVFFPSEGVSQVQKMQM
VTQEGSNVYAIAVDGNFDDAQNGVKRIFGDEDVTALMEEHGYKFSSANSINWGRLVPQIV
YYFSAYADMIKNGEIKAGEKINFVVPTGNFGNILAAYYAMQMGLPVNKLICASNDNNVLT
DFINTGEYNKNREFKKTLSPSMDILISSNLERLLYLITGDNAEKVCEWMNQLKNVGSYSV
DQDTKKKIQSIFWAGYTNDSDTLKTIESVYQETGYVLDTHTAVAVDVYDKYVISTSDVTK
AVIVSTASPFKFNDSVLKAIAGEEAIKGKTEFELLSVLSEKSGLKIPAPLKELDKKPVLH
KEFCEPINMIGKVKEALKIQENIKTAK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagaagcacaagaggaagctgcagaagtgtgagtgcagctgaagctataaaa
agaggtattgcagcagacggaggtctgtttgtacctgaaaagacagttcagtttaatcta
gaacaaatagctctcatgagtgaaatgagttatcaggaaagagcagttaagatacttgaa
ggatatttggacgattatactaatgaagaactattggagtgcgtaaacaaggcttataca
gcagagaaatttgaaactaatgatattgcccctttgcataagctttatgattcggtaaat
attttggaactttggcatgggcctacaagtgcatttaaagatatggctcttcagatactt
ccgcattttcttgttaaggcacttaaaaagacaggagaaaaagaagaaatagttatattg
gttgcgacatcaggagataccggaaaagctgctcttgaagggtttaaggatgtaattggg
acaaaaattattgtatttttcccaagtgaaggtgtcagtcaggtacagaaaatgcagatg
gtaactcaggaaggtagcaatgtatacgctattgcagtagatggtaactttgatgatgct
caaaacggagttaaaagaatattcggtgatgaggatgtaactgctttaatggaagaacat
ggatacaagttttcatcagcaaactctataaactggggaaggctagttccacaaatcgtt
tattatttttcagcatatgctgatatgataaagaatggcgaaattaaagcaggagaaaag
ataaattttgttgttcctacaggtaattttggtaatattctggctgcttactatgctatg
cagatgggtttgcctgttaacaagcttatttgtgcttcaaatgacaacaatgtgctgacc
gactttattaatacaggagaatacaataaaaacagagaattcaaaaagactttatctcct
tctatggatattcttatatcaagcaatctggaaagactattatacctgataacaggtgac
aatgctgaaaaggtttgtgaatggatgaaccagcttaaaaatgtcggttcatacagcgta
gatcaagacaccaaaaagaaaatccagagtattttctgggcaggatataccaatgatagt
gacactttaaaaactattgagagtgtttaccaggagacaggatatgtattagatacgcat
actgctgttgcagtggacgtgtacgacaaatatgttatttctacaagtgatgttacaaaa
gctgttattgtttctactgcaagtcctttcaagtttaacgatagtgttttaaaggctata
gcaggagaagaggctattaaaggaaagactgaatttgagcttctgtctgtactatcggaa
aagtcaggacttaaaattcctgctccgttgaaggaattggataaaaaacctgttctacac
aaggaattttgtgagccgataaatatgatcggtaaggttaaggaagcattaaaaatccaa
gaaaatattaagacagcaaaataa

DBGET integrated database retrieval system