KEGG   Clostridium cellulolyticum: Ccel_1597Help
Entry
Ccel_1597         CDS       T00835                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cce  Clostridium cellulolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cce00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cce00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cce00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1935982..1937397)
Genome map
AA seq 471 aa AA seqDB search
MKKIKRLIALVILTAVFISPFPPTVQNGNQVLALNNSLGLTPPMGWNSWNIFGGDINEEK
IKQITDAMVTTGMKDAGYEYVNIDDNWMANPARDANGILIPDPKRFPNGMKALADYIHSK
GLKFGIYGDRGVTTCCNIPQSGSQGYEEQDAKTFAQWGVDYLKYDNCASDSNLQAGYEKM
RDALLKTGRPIFYSICCWYFAGAWMVDCGNSWRTTGDISDNWRSIIKNIDENSKSAAYAG
PGHWNDPDMLEVGNGNMTETEYKAHFSMWCMMAAPLIAGNDLRNMTPATKDILTNKEVIA
INQDAAGVQGTKVSTSGELEVWCKPLGTDGTTKAVALLNRGAASADITVNWRDIKLADGP
ATVRDLWEHKDYGKFNTEYTANVPSHGVVVLKVQASSTDTDIMYGDVDGSGMIDALDYSL
VKRYLLDQISDFPASNGKLTADVDGDSQITALDFSLIKQYLLGIVNKFPVQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaacgccttattgctttggtaattttaacagctgtgtttatctcgcca
tttccgccgactgtgcaaaatggcaatcaagtgctggcactgaataacagtctgggattg
accccgcccatggggtggaacagctggaacatctttggaggtgacatcaatgaggaaaag
atcaagcaaatcacagatgctatggttaccacaggtatgaaggatgcaggctatgagtat
gtcaatattgatgataattggatggcaaaccctgcacgtgacgctaatggaatacttatt
ccggatcccaaacgttttcctaacggtatgaaagctttagcagattatattcattcaaaa
gggttaaaatttggaatttatggtgacaggggagtaaccacatgctgtaatattccccag
agtggaagccaaggatatgaggaacaagacgcaaaaacttttgctcaatggggtgtagat
tatttgaaatatgataactgtgcttcagacagcaatttgcaggcaggctacgaaaaaatg
cgggatgctcttttgaaaacaggaagacctattttctatagcatatgctgctggtatttt
gcaggtgcgtggatggtagattgcggtaattcttggagaacaacaggagatattagtgac
aactggcgaagtattataaagaatattgatgaaaactccaagtcagccgcgtatgcaggc
ccgggccattggaatgatccagatatgctagaggttggtaacggtaatatgacagagact
gaatacaaagcacatttcagcatgtggtgcatgatggcagctccgcttattgctggaaat
gaccttaggaatatgactcctgctactaaagatattcttactaacaaagaggtaattgct
attaatcaagatgctgctggcgtgcaaggcaccaaggtaagtacttcgggagaacttgaa
gtgtggtgtaaaccgctagggacagatggcactaccaaggcagttgcactgttaaatcgc
ggagccgcatcggcagatatcacagttaattggagagatataaagcttgccgatgggcct
gccactgttcgtgatctttgggagcacaaggattacggcaagtttaacactgagtataca
gccaatgtaccttctcacggtgtggtggtattaaaagttcaagcaagctccaccgatacg
gatataatgtatggtgatgttgatggaagtggcatgattgatgcactggattattcatta
gttaaaaggtatctgctagaccagatttccgactttcctgcttcaaacggcaaacttact
gccgatgttgatggagacagtcaaataacagcgctggatttttcattaattaagcaatat
ttgctgggtattgttaataaattccctgtgcaataa

DBGET integrated database retrieval system