KEGG   Clostridium cellulolyticum: Ccel_1760Help
Entry
Ccel_1760         CDS       T00835                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cce  Clostridium cellulolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ccel_1760
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Ccel_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2107610..2108596)
Genome map
AA seq 328 aa AA seqDB search
MQETLKTVTQAFGVSGNEEEIREIITTEIKKYVDEIKVDAMGNLIAVKKGKKKKILFAAH
MDEIGVIATFIDDNGFIRFSNLGGVSAFNSLAQRVRFQNGTIGCINVEEKLESMKTLRLG
KMYIDIGCTSKEEAEKYVKVGDTASFTGDFHVQGDYAVSKAMDDRSGCAVLIELIKTMPK
TDNEIYFVFTTQEELGLRGAKTASFGIMPDCAIAIDVTRTGDTPECNSMEVKLGKGPAIK
VKDSSYIAHPQIRRILQNLAQENGIPYTLELLDRGGSDPGAMQTSGTGIPCGGISIPCRY
VHTPCEMVSIQDLNNCVKLAGLFMKRYK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaacattaaaaacagttacacaagcttttggtgtatctggaaatgaagaagag
atcagagaaataattacaactgaaataaaaaaatatgttgatgaaataaaagtagatgca
atgggtaatctgattgctgtaaaaaaaggaaagaagaagaaaatactgtttgcggcccat
atggatgaaattggagttatagctacctttattgatgataacgggttcataaggttctcc
aacttagggggagtatcggcgtttaattcacttgcacaaagagtaaggtttcaaaacggt
acaatcggttgcataaatgtggaagaaaaacttgaaagtatgaaaactctcagacttgga
aaaatgtatattgatattggctgcaccagcaaagaggaagctgagaaatacgtcaaggtc
ggagatacagccagctttacaggagattttcatgttcagggagattatgccgtttcaaag
gcaatggatgacagaagcggctgtgcagtacttattgagcttataaaaaccatgcctaaa
acagataatgaaatctactttgtctttacgacacaggaagaattgggactaagaggtgca
aaaaccgcttctttcggaattatgccggattgtgccattgcaattgatgttacacgtaca
ggtgatactcccgaatgtaacagtatggaagtaaagcttggcaagggccctgcaataaaa
gtaaaagattcttcttatatagctcatccacagattcgtaggattttacagaatttggca
caggaaaatgggattccctacactttggaattgcttgataggggagggagtgaccctggt
gcaatgcagacgtcaggaacagggattccatgcggtgggatatcaattccatgcagatat
gtccatactccttgtgaaatggtgagtattcaggatttaaacaattgtgttaagcttgcc
ggactgtttatgaaacgttacaagtaa

DBGET integrated database retrieval system