KEGG   Clostridium cellulolyticum: Ccel_1761Help
Entry
Ccel_1761         CDS       T00835                                 

Definition
(GenBank) peptidase M42 family protein
Organism
cce  Clostridium cellulolyticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACL76112
JGI: Ccel1761
UniProt: B8I2W9
Position
complement(2108628..2109674)
Genome map
AA seq 348 aa AA seqDB search
MMLIKELTDLNGVSGNENEVREYIKSKINGLCDSIEVDSIGNIIAYKKGSSGKYKVMLSA
HMDEVGFMVSGYMEKGFLKFKPVGGIDSRILPGKRVVIGKKRLKGVIGAKPLHQQSSEER
ERIAKIKDLYIDIGAETKEEAEKMAPLGEFIAFDSEYVELGKDCIKAKALDDRIGCAVLM
EVLKYNFEFDLYACFTVQEEVGLRGAQVAAFKIMPDIALVLEGTTCADVPEVKPFDFSTV
LGNGAALTLVDRTCYSDRKLVQFLYDTAVKNGIKVQYKQTTTGGNDAGQIQRTGTGVKTA
SISVPCRYIHSPVSVMSMSDFECVERLTLAALNEMNKDKDFIKNIAAV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgataaaagaactaacagatttaaacggtgtatcaggaaatgaaaatgaagta
agagaatatattaaaagtaaaattaatggactgtgtgattctatagaagtagattcaata
ggaaatattattgcgtataaaaaaggcagcagcggcaagtataaagtcatgctttcagcc
catatggatgaagttggattcatggtttcaggatatatggaaaaaggatttttgaaattc
aaacctgtcgggggtattgacagcagaattttacccggtaaaagggttgtaataggtaaa
aaaaggctcaaaggcgtaataggtgcaaaaccgctacatcagcaaagttctgaagaacgg
gaaaggatagcgaaaatcaaggatttatatatagatattggggcggaaacaaaggaagag
gccgaaaaaatggctcctttaggtgagttcattgcctttgacagcgagtatgtagaattg
ggaaaagactgtataaaggcaaaagcacttgacgacagaattggctgtgcggtacttatg
gaggttttaaagtataatttcgagtttgatttgtatgcctgctttacagtacaggaagag
gttgggcttagaggtgcacaggtggctgcatttaaaattatgccggatatagcacttgtt
ctggaagggactacttgtgcggacgttccagaggtaaaaccctttgatttttcaacagta
ctcggtaatggtgcagcacttacattggtagacagaacctgttacagcgacagaaagctt
gtacagtttttatatgatacagcagttaaaaacggcattaaggttcaatacaagcagacc
accacaggtggaaatgatgcgggacaaatacaaagaaccggtacgggagttaaaactgcc
tcaatatcggtgccctgcaggtatatacattctcctgtatctgttatgagcatgagtgat
tttgaatgtgtagaaaggcttacacttgcagcattaaatgaaatgaacaaagataaggat
tttataaaaaacatcgcagcagtatag

DBGET integrated database retrieval system