KEGG   Clostridium cellulolyticum: Ccel_1762Help
Entry
Ccel_1762         CDS       T00835                                 

Definition
(GenBank) peptidase M42 family protein
Organism
cce  Clostridium cellulolyticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2109728..2110786)
Genome map
AA seq 352 aa AA seqDB search
MEISNCLEYLSGLVAVAGFEASAAAKIAETFRDYCDEVRIDKFFNVIFLKKGFNKSAKKI
LITAHIDEIGFLVNSIDDKGFIGISPIGGIDSKILLAQEVIIHGSEDIPGIIGAMPPHLM
KQEDAGKAVKIKDLRVDTGLKGEELKKIVSIGDVVSLKSSFSLMNKNKASGKSFDNRTGI
VCMMEILRGLKDINHENDIIFMASTQEETSLVGVTTAAFALMPDAAIVIDVCHGDIPELS
KGMSSTPGKGPEISIGPNLHKGMVEKMFELAKDICIPFQKMVESGDTGTEAWATQVSGCG
IPTALLSIPVRYMHTAVETVNLDDIKFAARIITEFARLSSEKLETLLEWKNI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttcaaattgtttagagtatttgtcaggacttgtggcagtagcaggctttgaa
gcaagtgctgcggcaaaaatcgcagaaacctttagggattactgcgatgaagtccgaata
gataagttttttaatgtaattttcctgaaaaagggttttaataagtctgcaaaaaagatt
ttgattacagcacacattgatgaaataggctttctggtcaactcaatagacgataaaggg
tttatcggtataagcccaattggaggaatagacagcaaaatactgctggcacaggaagta
ataatccatggcagtgaggatatccccggcataataggggcaatgccgccgcacctgatg
aaacaggaggatgctggaaaggctgtaaaaataaaggatttacgtgttgatacaggacta
aagggggaggaacttaaaaaaatcgtttcaataggagatgttgtgtcccttaaatcaagc
ttctctttaatgaacaaaaacaaagccagcggaaagtcttttgacaatcgtacaggtatt
gtctgtatgatggaaatattacggggcctaaaggatattaatcatgaaaatgatattata
tttatggcttcaacacaggaagaaacaagccttgtgggggttactacagcagcttttgca
ttaatgccggatgctgcaatagtaattgacgtatgccatggagatatccctgagctttca
aagggtatgtcctcaacacccggcaaagggccggagatatcaataggccctaaccttcat
aaagggatggtagaaaagatgtttgagcttgctaaagacatatgcattccatttcagaaa
atggttgagtcaggcgatacggggactgaagcatgggcaactcaagtcagtggctgcgga
atacccactgctctgctttctatcccggtcaggtacatgcatacggctgtagaaacggta
aatttggacgatataaaatttgcggccagaataataactgagttcgccaggctgagcagt
gagaaattagagactcttctggaatggaagaatatctga

DBGET integrated database retrieval system