KEGG   Clostridium cellulolyticum: Ccel_1762Help
Entry
Ccel_1762         CDS       T00835                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cce  Clostridium cellulolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cce00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2109728..2110786)
Genome map
AA seq 352 aa AA seqDB search
MEISNCLEYLSGLVAVAGFEASAAAKIAETFRDYCDEVRIDKFFNVIFLKKGFNKSAKKI
LITAHIDEIGFLVNSIDDKGFIGISPIGGIDSKILLAQEVIIHGSEDIPGIIGAMPPHLM
KQEDAGKAVKIKDLRVDTGLKGEELKKIVSIGDVVSLKSSFSLMNKNKASGKSFDNRTGI
VCMMEILRGLKDINHENDIIFMASTQEETSLVGVTTAAFALMPDAAIVIDVCHGDIPELS
KGMSSTPGKGPEISIGPNLHKGMVEKMFELAKDICIPFQKMVESGDTGTEAWATQVSGCG
IPTALLSIPVRYMHTAVETVNLDDIKFAARIITEFARLSSEKLETLLEWKNI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttcaaattgtttagagtatttgtcaggacttgtggcagtagcaggctttgaa
gcaagtgctgcggcaaaaatcgcagaaacctttagggattactgcgatgaagtccgaata
gataagttttttaatgtaattttcctgaaaaagggttttaataagtctgcaaaaaagatt
ttgattacagcacacattgatgaaataggctttctggtcaactcaatagacgataaaggg
tttatcggtataagcccaattggaggaatagacagcaaaatactgctggcacaggaagta
ataatccatggcagtgaggatatccccggcataataggggcaatgccgccgcacctgatg
aaacaggaggatgctggaaaggctgtaaaaataaaggatttacgtgttgatacaggacta
aagggggaggaacttaaaaaaatcgtttcaataggagatgttgtgtcccttaaatcaagc
ttctctttaatgaacaaaaacaaagccagcggaaagtcttttgacaatcgtacaggtatt
gtctgtatgatggaaatattacggggcctaaaggatattaatcatgaaaatgatattata
tttatggcttcaacacaggaagaaacaagccttgtgggggttactacagcagcttttgca
ttaatgccggatgctgcaatagtaattgacgtatgccatggagatatccctgagctttca
aagggtatgtcctcaacacccggcaaagggccggagatatcaataggccctaaccttcat
aaagggatggtagaaaagatgtttgagcttgctaaagacatatgcattccatttcagaaa
atggttgagtcaggcgatacggggactgaagcatgggcaactcaagtcagtggctgcgga
atacccactgctctgctttctatcccggtcaggtacatgcatacggctgtagaaacggta
aatttggacgatataaaatttgcggccagaataataactgagttcgccaggctgagcagt
gagaaattagagactcttctggaatggaagaatatctga

DBGET integrated database retrieval system