KEGG   Clostridium cellulolyticum: Ccel_1791Help
Entry
Ccel_1791         CDS       T00835                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00230  Purine metabolism
cce01100  Metabolic pathways
Module
cce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ccel_1791
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ccel_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_33 AAA_16 Cytidylate_kin MMR_HSR1 RNA_helicase AAA_17 AAA RsgA_GTPase ADK T2SSE ABC_tran NTPase_1 AAA_28 cobW AAA_30
Motif
Other DBs
NCBI-ProteinID: ACL76141
JGI: Ccel1791
UniProt: B8I2Z8
Position
complement(2146513..2147118)
Genome map
AA seq 201 aa AA seqDB search
MQQKGLLVVVSGPSGTGKGTVCKKLLSQRDNVRYSVSATTRKPREGEIEGQSYFFVSESK
FLDMIKNDALIEWDKYCDNYYGTPKSYVDSSMESGMDIILEITVEGALEIKQKYPDSVLI
FILPPSFEELRRRIECRATECTDVIEKRLQKAASEIKYVSKYDYLILNDSVDEAVMNIEK
VLDSERLKPSRNVEIIESLFK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaaaggcttgttagttgtagtgtccggtccttcaggaacaggaaagggtacg
gtatgtaaaaagttgttgtctcaaagggataacgtaaggtattctgtctcagctactaca
aggaaaccacgtgaaggcgaaatagaaggtcagagttatttctttgtttcagaaagcaaa
tttttggatatgataaagaacgatgcccttattgagtgggataagtactgtgacaattac
tatggtacaccaaagtcatatgttgattcctctatggaaagtggtatggatataatattg
gaaataaccgttgaaggggcccttgaaattaagcaaaagtacccggattccgtacttata
tttattcttcctccatcctttgaagaattaagaagacgaatagaatgtagggctacagag
tgtactgacgttatagaaaaaagactgcaaaaggctgccagtgagattaaatatgtttca
aaatatgactatttaatattaaatgacagtgttgatgaagctgttatgaatatagaaaaa
gttttagacagtgagcgtctaaaaccatctagaaatgttgaaataatagaaagcttattt
aagtaa

DBGET integrated database retrieval system