KEGG   Clostridium cellulolyticum: Ccel_2260Help
Entry
Ccel_2260         CDS       T00835                                 

Definition
(RefSeq) bifunctional phosphoglycerate kinase/triosephosphate isomerase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccel_2260
   01230 Biosynthesis of amino acids
    Ccel_2260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccel_2260
   00051 Fructose and mannose metabolism
    Ccel_2260
   00562 Inositol phosphate metabolism
    Ccel_2260
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Ccel_2260
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ccel_2260
Exosome [BR:cce04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ccel_2260
  Exosomal proteins of colorectal cancer cells
   Ccel_2260
  Exosomal proteins of bladder cancer cells
   Ccel_2260
  Exosomal proteins of melanoma cells
   Ccel_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2638216..2640156)
Genome map
AA seq 646 aa AA seqDB search
MSMMNKKTIEDIDVAGKRVIVRVDFNVPLDENRKITDDKRIVGALPTIKYLVDKGAKTIL
VSHLGRPKEGFEDKFSMKPTAVRLGELLGKEIIMAKDVVGEDAKSKAAALKDGEVLMLEN
VRFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEIE
FMGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNS
ICEEDKIDLAKTLMEKAEAKGVEIMLPIGSMVAQEFKNDTEIKYVPSDAMPDGWMGMDIG
SLTIENFAKEIKKAKTVIWNGPMGVFEFPNFATGTKEIAKAVAESGALSIVGGGDSAAAV
EQLGFADKITHISTGGGASLEFLEGKELPGIAVLMDKNPRKVIAAGNWKMNKTASEAVEF
VNALKPAVADAKNEVVVGVPFVCLPGVVAAAKGSNIKVAAQNMHWEEKGAFTGEVSGPML
ADLGVDYVIIGHSERREYFGETNEMINKKAHAIFKYGMTPIICCGETLTQREQGVTADHI
RYQIKVALLDLTAEQVSKLVIAYEPIWAIGTGKTATNEQANEVCTIIRELVAELYGSEVA
EHVRIQYGGSVNAKNATELFAMSDIDGGLVGGASLKVEDFSIIAKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatgaacaaaaaaacaattgaagacattgatgttgccggtaaaagggtaata
gtaagagttgattttaacgtaccattggatgaaaacagaaagattactgatgacaagaga
atagttggagcacttcctacaataaagtatctcgttgacaagggagcaaagactatactt
gtatcccatttgggaagacccaaggaaggttttgaagataaattcagcatgaagccgaca
gctgttagacttggagaacttcttggaaaagaaataataatggctaaagatgttgtaggc
gaagatgccaagtcaaaggcagcagcattaaaagacggcgaagttcttatgcttgagaac
gtaagattccataaggaagaaacaaagaatgatgctaactttgcaaaagaacttgcaagc
atggctgaaatatttgtaaacgacgcattcggaacagctcacagggcacacgcttctact
gctggattggctgactatcttcctgctgtatgcggattccttataaagaaagaaattgaa
ttcatgggtaaagcactggctaaccctgcaagaccattcgttgcaatccttggtggtgca
aaggtttctgacaaaattgcagttatcgaaaacctcattgacaaggttgataccttgata
atcggcggtggtatggcttacaccttcttaaaggcaaaaggataccatattggaaattca
atctgtgaagaagacaagattgacctggcaaagacactaatggaaaaagctgaagcaaag
ggtgttgaaataatgcttccgataggaagtatggtagctcaggaattcaagaatgatact
gaaataaaatacgttccatcagatgcaatgcctgacggatggatgggtatggatatagga
tcacttacaatagaaaattttgcaaaagaaataaagaaagcaaagacagttatctggaac
ggacctatgggtgtttttgaattccctaacttcgcaacaggtacaaaggaaattgcaaag
gcagttgcagaatctggagcactttcaatagttggaggaggagattcagctgctgcagtt
gaacagcttggttttgcagataagattacacatatttcaacaggtggaggagcttctctt
gaattcctcgaaggtaaagagcttcccggtatagcagtacttatggataaaaatccaaga
aaagtaattgctgctggtaactggaaaatgaataagactgcttctgaagctgttgaattc
gtaaatgcattaaagcctgctgttgctgacgcaaaaaatgaagtggttgttggtgttccg
tttgtatgcctgcccggcgttgttgcagctgcaaagggttcaaatataaaggttgcagct
cagaatatgcactgggaagaaaagggagcattcactggagaagtatccggcccgatgctg
gcagaccttggtgttgactatgtaataatcggtcactccgaaagaagagaatatttcggt
gaaaccaacgaaatgataaataaaaaggctcatgcaatatttaaatatggtatgactccg
attatctgctgtggtgaaacactcactcagagagaacagggtgttacagctgaccatatc
agatatcagataaaggtagcattacttgatttgactgctgaacaagttagcaagcttgta
attgcttacgaaccaatctgggcaatcggaacaggaaagactgctacaaacgaacaggca
aatgaagtttgcacaattatcagagaattggttgcagagctctatggttcagaagtagct
gaacatgttagaattcagtacggcggaagtgtaaatgctaagaatgctactgaactgttt
gcaatgtctgacatagatggcggacttgttggtggagcaagcttaaaggttgaggatttc
tcaataatcgcaaaagcataa

DBGET integrated database retrieval system