KEGG   Clostridium cellulolyticum: Ccel_2260Help
Entry
Ccel_2260         CDS       T00835                                 

Definition
bifunctional phosphoglycerate kinase/triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccel_2260
   01230 Biosynthesis of amino acids
    Ccel_2260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccel_2260
   00051 Fructose and mannose metabolism
    Ccel_2260
   00562 Inositol phosphate metabolism
    Ccel_2260
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Ccel_2260
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ccel_2260
Exosome [BR:cce04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ccel_2260
  Exosomal proteins of colorectal cancer cells
   Ccel_2260
  Exosomal proteins of bladder cancer cells
   Ccel_2260
  Exosomal proteins of melanoma cells
   Ccel_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2638216..2640156)
Genome map
AA seq 646 aa AA seqDB search
MSMMNKKTIEDIDVAGKRVIVRVDFNVPLDENRKITDDKRIVGALPTIKYLVDKGAKTIL
VSHLGRPKEGFEDKFSMKPTAVRLGELLGKEIIMAKDVVGEDAKSKAAALKDGEVLMLEN
VRFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEIE
FMGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNS
ICEEDKIDLAKTLMEKAEAKGVEIMLPIGSMVAQEFKNDTEIKYVPSDAMPDGWMGMDIG
SLTIENFAKEIKKAKTVIWNGPMGVFEFPNFATGTKEIAKAVAESGALSIVGGGDSAAAV
EQLGFADKITHISTGGGASLEFLEGKELPGIAVLMDKNPRKVIAAGNWKMNKTASEAVEF
VNALKPAVADAKNEVVVGVPFVCLPGVVAAAKGSNIKVAAQNMHWEEKGAFTGEVSGPML
ADLGVDYVIIGHSERREYFGETNEMINKKAHAIFKYGMTPIICCGETLTQREQGVTADHI
RYQIKVALLDLTAEQVSKLVIAYEPIWAIGTGKTATNEQANEVCTIIRELVAELYGSEVA
EHVRIQYGGSVNAKNATELFAMSDIDGGLVGGASLKVEDFSIIAKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatgaacaaaaaaacaattgaagacattgatgttgccggtaaaagggtaata
gtaagagttgattttaacgtaccattggatgaaaacagaaagattactgatgacaagaga
atagttggagcacttcctacaataaagtatctcgttgacaagggagcaaagactatactt
gtatcccatttgggaagacccaaggaaggttttgaagataaattcagcatgaagccgaca
gctgttagacttggagaacttcttggaaaagaaataataatggctaaagatgttgtaggc
gaagatgccaagtcaaaggcagcagcattaaaagacggcgaagttcttatgcttgagaac
gtaagattccataaggaagaaacaaagaatgatgctaactttgcaaaagaacttgcaagc
atggctgaaatatttgtaaacgacgcattcggaacagctcacagggcacacgcttctact
gctggattggctgactatcttcctgctgtatgcggattccttataaagaaagaaattgaa
ttcatgggtaaagcactggctaaccctgcaagaccattcgttgcaatccttggtggtgca
aaggtttctgacaaaattgcagttatcgaaaacctcattgacaaggttgataccttgata
atcggcggtggtatggcttacaccttcttaaaggcaaaaggataccatattggaaattca
atctgtgaagaagacaagattgacctggcaaagacactaatggaaaaagctgaagcaaag
ggtgttgaaataatgcttccgataggaagtatggtagctcaggaattcaagaatgatact
gaaataaaatacgttccatcagatgcaatgcctgacggatggatgggtatggatatagga
tcacttacaatagaaaattttgcaaaagaaataaagaaagcaaagacagttatctggaac
ggacctatgggtgtttttgaattccctaacttcgcaacaggtacaaaggaaattgcaaag
gcagttgcagaatctggagcactttcaatagttggaggaggagattcagctgctgcagtt
gaacagcttggttttgcagataagattacacatatttcaacaggtggaggagcttctctt
gaattcctcgaaggtaaagagcttcccggtatagcagtacttatggataaaaatccaaga
aaagtaattgctgctggtaactggaaaatgaataagactgcttctgaagctgttgaattc
gtaaatgcattaaagcctgctgttgctgacgcaaaaaatgaagtggttgttggtgttccg
tttgtatgcctgcccggcgttgttgcagctgcaaagggttcaaatataaaggttgcagct
cagaatatgcactgggaagaaaagggagcattcactggagaagtatccggcccgatgctg
gcagaccttggtgttgactatgtaataatcggtcactccgaaagaagagaatatttcggt
gaaaccaacgaaatgataaataaaaaggctcatgcaatatttaaatatggtatgactccg
attatctgctgtggtgaaacactcactcagagagaacagggtgttacagctgaccatatc
agatatcagataaaggtagcattacttgatttgactgctgaacaagttagcaagcttgta
attgcttacgaaccaatctgggcaatcggaacaggaaagactgctacaaacgaacaggca
aatgaagtttgcacaattatcagagaattggttgcagagctctatggttcagaagtagct
gaacatgttagaattcagtacggcggaagtgtaaatgctaagaatgctactgaactgttt
gcaatgtctgacatagatggcggacttgttggtggagcaagcttaaaggttgaggatttc
tcaataatcgcaaaagcataa

DBGET integrated database retrieval system