KEGG   Clostridium cellulolyticum: Ccel_2320Help
Entry
Ccel_2320         CDS       T00835                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cce  Clostridium cellulolyticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2706866..2710018)
Genome map
AA seq 1050 aa AA seqDB search
MYRNRNKVLALLLAFAMIISVMPMSAVMAETKTTYHETFADGKGAATQSGGATLEKVGNK
VFEGNDDGAALYVSNRKNNWDAADFKFNDIGLKNGKTYSITVKGFVDSNAKVPAGAQAFL
QVVNSYAWLAGSDFVAGKAFTLSGKYTVDTSKDDGIRVQSNDEGKEVPFYIGDISITEEA
VEEVPEDPSRPKAETFKTITFEDKTTGGFGARSGEGGEKLTVTKEANHTDGGSYALKVEN
RTMTWHGPSMNVEKFVSQGSEYKVTAWVKLASPESSQLQLSTQVGNGGTASYVSLAAKTI
STSDGWVKYEGTYRYNNVSSEYITIYVESASSANASFYIDDISFEQTGSGPIKIQNDLES
IKNVYKKDFLIGNAIAAEDMEGVRLDLLKKHFNVMTAGNAMKPDALQPTKGNFTFADADK
LVDKVLAEGFEMHGHTLVWHQQSPAWLNTKVDASGNAVPLSREEALTNLKTHIKTVVEHY
GNKVISWDVVNEGMNDNPSNPEDWRGALRQSPWYQAIGPDYMEQAFLAAREVLDAHPDWD
VKLYYNDYNDDNQNKSKAIYYMVKELNEKYAKTHPGKLLIDGVGMQAHYNMSTNPSNVEL
SLERFISLGVEVSITELDVQAGSDFKLTDEIANAQGYLYAQLFDIYKKHAANISRITIWG
LDDGTSWRSSTNPLPFDKNLQAKPAFFGTVDPAKFMNEHQPQTPKNAKYTTARYGTPVID
GTVDSVWSKAQDIPINQYQMAWQGATGTAKALWDDKNLYVLVQVSDSELDKKSVNTYEQD
SVEVFIDENNGKTTFYQDDDGQYRVNYDNETSFNPESISTGFKSATKVSGTSYTVEIKIP
LKSVTPSNNLKIGFDVQINDAKDGSRKSVATWNDTTGNGYQDTSVYGVLTLSNSDSNNTS
QYITRGEFIDSIIKALGLNKNVQVKDSFKDVTKDSSYYASVSVAYQKGIVSGYKNGEFKP
QAKITRQEAMTIIAKAMKAAGKNVNYSADEINKILKEFKDSNKVAGWAKGSVAACIKAGI
VSGKSGKMLAPQENITFSQTESIVKKLSAK
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggaacagaaataaagtcttagcgttgcttttagcttttgcaatgatcatttcc
gttatgcctatgagtgctgtaatggctgaaacaaaaactacttatcatgaaacctttgca
gatggtaaaggagcagcaacccaatccggaggagctactctcgagaaggttggtaataag
gtttttgaaggtaatgatgacggagccgcattatatgtaagcaatagaaaaaacaattgg
gatgcggctgattttaaattcaacgatattggactaaaaaacggtaagacttatagcata
acagtaaaaggttttgttgactccaatgccaaggttccagcaggtgcacaggcatttctt
caggttgtcaacagctacgcatggctggcaggttcggactttgttgcgggaaaagctttt
actttgagcggaaagtatactgtggatacctcaaaggatgacggaatacgcgttcaatcc
aatgatgaaggcaaagaggttcctttttatattggagacatttcaattacagaagaggct
gttgaagaagtacccgaggatcccagcagaccaaaggcggaaacttttaaaacaataaca
tttgaggataaaacaacaggtggctttggagccagaagcggtgagggaggagaaaaactg
accgtaacaaaagaagccaaccataccgatggcggttcatatgctttaaaagtagaaaac
agaacaatgacttggcatggcccttccatgaatgtggagaagtttgtaagccaaggtagt
gaatacaaggttactgcatgggtaaaacttgctagtcctgaaagctcacaacttcaactt
tccactcaggttggaaacggcggcactgcttcttatgtaagccttgcagcaaaaacaatc
agtacttctgatggttgggttaagtatgagggtacataccgctacaacaatgtttcaagt
gaatatattactatatatgtagaaagtgcaagcagtgccaatgcttctttctatattgac
gatatcagctttgaacaaacaggttcaggcccaatcaaaatccaaaatgatttggaatct
atcaaaaatgtatataagaaggatttccttataggaaatgcaatagcagcagaggatatg
gaaggggtcagacttgaccttttaaagaagcactttaatgtaatgactgctggaaatgct
atgaagcctgatgcattacagcctacaaagggcaactttacatttgcggatgcagataag
ctagttgacaaggttctggcagagggatttgagatgcacggacatacgttggtatggcat
caacagtcacctgcatggcttaatacaaaagtagatgcaagcggaaatgccgtacctttg
tcacgtgaggaagctcttacaaatctaaaaacccatatcaagacagttgtagagcactac
ggtaacaaggtaatatcctgggacgtagtaaatgaaggtatgaacgataatccttctaac
cctgaagactggaggggagcattgcgtcaaagcccatggtatcaggcaattggtcctgat
tacatggaacaagcgtttttagcggcaagagaggttcttgatgctcatcctgattgggat
gtgaagctttattataatgattataacgatgataatcaaaataaatctaaagctatttac
tacatggtaaaagaattaaatgaaaaatatgctaaaactcacccgggcaaacttcttatc
gacggagtaggtatgcaggcacattacaatatgtctacaaatccttctaatgttgaactt
tcattggagagatttatttctctgggtgttgaagtaagcataacagagcttgatgttcaa
gcaggcagcgacttcaagttaaccgatgaaattgcaaatgcacagggatatttatatgca
cagttattcgatatatataagaagcatgcagcaaatataagccgtattactatatgggga
ttggatgatggtacaagctggagatcatccacaaatcctttgccgtttgacaagaatctt
caggcaaagcctgcattttttggcacagtagatcctgcaaaatttatgaatgaacatcaa
cctcagacacctaaaaatgcaaaatatacaacagccagatacggtacccctgtaattgac
ggtactgttgacagtgtttggagtaaagcacaggatatacctataaaccagtatcaaatg
gcatggcagggagcaacaggaactgcaaaggctctatgggatgacaagaacctgtatgtt
cttgttcaggtcagcgactccgaacttgataagaaaagtgtaaacacatacgaacaagat
tcagttgaagtattcattgatgagaataatggaaaaactacattctatcaggatgatgac
ggtcagtacagagttaattatgacaacgagacttcatttaatcctgaatcaatttcaacc
ggatttaaatctgcaacaaaggtttcaggaacaagctataccgttgaaataaagattcct
cttaaatcagtaacaccatccaataatttaaaaataggctttgatgttcagataaatgat
gctaaagatggttcacgtaagagtgttgctacatggaatgatactaccggaaatggatat
caggatacttcggtatatggtgttctaaccctcagtaattccgacagcaataatacatcc
caatatattacaagaggagaatttattgattctatcattaaagctttgggtctgaataaa
aatgttcaggttaaagactcctttaaggatgtaaccaaggattccagctattatgcttct
gtaagtgttgcttaccagaagggaatagtatctggatacaaaaacggagagttcaagccg
caggctaagattactcgtcaagaagcaatgacaataattgccaaggctatgaaggcagca
ggaaagaatgttaactactcagctgatgagataaataaaatacttaaggaatttaaggat
tcaaataaagttgccggatgggcaaaaggttctgttgctgcttgtattaaagcaggaatt
gtatctggcaaaagcggaaaaatgctggcaccacaagaaaatataactttttcacaaaca
gaatcaatagtaaagaaattgtccgcaaaataa

DBGET integrated database retrieval system