KEGG   Clostridium cellulolyticum: Ccel_2450Help
Entry
Ccel_2450         CDS       T00835                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00260  Glycine, serine and threonine metabolism
cce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01130  Biosynthesis of antibiotics
cce01230  Biosynthesis of amino acids
Module
cce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_2450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_2450
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL76779
JGI: Ccel2450
UniProt: B8I614
Position
2957892..2959256
Genome map
AA seq 454 aa AA seqDB search
MRRDEISKVILSEKDIPKQWYNIVADMPNKPAPYHNPATLDIIKPDDMKAIFPDEVIRQE
MSTERYIDIPDEVRQRYCQFRPSPLYRARALEKQLDTTARIYYKYEGTNATGSHKLNSAI
PQVYYNKLAGIKRLATETGAGQWGSALSLATSQFGLECSVYMVNVSYQQKPYRRSFMKTF
GANVVASPSTLTNSGRSILEIDPDCSGSLGIAISEAVEDAATHADTNYALGSVLNHVCLH
QTIIGIEAKKQMEYLDEYPDVIFACCGGGSNFAGIAFPFLQDKLNGHNLRAVAVEPSACP
TLTKGVFAYDYGDTAKAAPITKMYTLGHDFIPSGIHAGGLRYHGGSAIVSQLYHDGIIEA
KAYGQKSVFEAAVAFARAEGIVPAPESAHAIRAAMDEAILAKESGEEKVILFCLSGHGYF
DFAAYENYFSGLIDDIEFSPESTKKSLQDLPNIK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagatgagatcagcaaggtaattctgtccgaaaaggatattcccaagcagtgg
tataacattgtagcagatatgcccaataaacccgctccctatcacaatcccgcaacactg
gatatcattaagcccgacgatatgaaagccattttccccgacgaagtaatcagacaggaa
atgtctaccgaacgttacatagacatacctgatgaagttcgccaaaggtattgccagttc
aggccaagtcctctatatagagcaagggctcttgaaaagcagcttgatactactgcaaga
atttattataaatatgaagggacgaatgctaccgggagccacaagcttaattctgcaata
ccccaggtatattacaataagctggcaggtattaaaagacttgcaactgaaacaggggct
ggtcaatggggcagtgctttaagtcttgcaacaagccaatttgggttggaatgttctgtt
tatatggttaatgtaagctatcagcagaagccttataggcgttcttttatgaaaaccttt
ggtgcaaatgttgtagcaagtcccagcacactaacaaacagtggacggagtattttagag
atagaccctgattgttcgggcagtcttggaatcgcaataagtgaggcggttgaggatgca
gcaacacacgcagataccaattatgcattgggaagtgttttaaaccacgtctgcctgcat
cagactataatcggtattgaagcaaaaaagcaaatggaatatttagatgaatatcccgat
gtaatttttgcttgctgcggaggcggaagcaattttgcaggtatagccttcccgttttta
caggataagctgaacggacataatttaagagctgttgctgttgaaccgtcagcatgtcct
actttgacaaagggtgtgtttgcatacgattacggagatactgcaaaagcagctccaata
acaaaaatgtatactttaggacatgactttattccctccggtatacatgcaggcggcttg
aggtaccacggaggctccgcaattgtcagccagctgtaccatgatggaatcattgaagca
aaagcgtacggtcagaagtctgtttttgaagcggcagtagcctttgcacgtgcagaggga
attgttcctgctcctgaatcggcacatgctataagggctgcaatggatgaagctatcctg
gcaaaggaatctggcgaggaaaaggttattctgttctgtctcagcggacacgggtacttt
gattttgcggcgtatgaaaactactttagcggactgattgatgatatagaattttcccct
gaatctactaaaaagagtttacaggatttaccaaacataaaatag

DBGET integrated database retrieval system