KEGG   Clostridium cellulolyticum: Ccel_2450Help
Entry
Ccel_2450         CDS       T00835                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_2450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_2450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_2450
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2957892..2959256
Genome map
AA seq 454 aa AA seqDB search
MRRDEISKVILSEKDIPKQWYNIVADMPNKPAPYHNPATLDIIKPDDMKAIFPDEVIRQE
MSTERYIDIPDEVRQRYCQFRPSPLYRARALEKQLDTTARIYYKYEGTNATGSHKLNSAI
PQVYYNKLAGIKRLATETGAGQWGSALSLATSQFGLECSVYMVNVSYQQKPYRRSFMKTF
GANVVASPSTLTNSGRSILEIDPDCSGSLGIAISEAVEDAATHADTNYALGSVLNHVCLH
QTIIGIEAKKQMEYLDEYPDVIFACCGGGSNFAGIAFPFLQDKLNGHNLRAVAVEPSACP
TLTKGVFAYDYGDTAKAAPITKMYTLGHDFIPSGIHAGGLRYHGGSAIVSQLYHDGIIEA
KAYGQKSVFEAAVAFARAEGIVPAPESAHAIRAAMDEAILAKESGEEKVILFCLSGHGYF
DFAAYENYFSGLIDDIEFSPESTKKSLQDLPNIK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagatgagatcagcaaggtaattctgtccgaaaaggatattcccaagcagtgg
tataacattgtagcagatatgcccaataaacccgctccctatcacaatcccgcaacactg
gatatcattaagcccgacgatatgaaagccattttccccgacgaagtaatcagacaggaa
atgtctaccgaacgttacatagacatacctgatgaagttcgccaaaggtattgccagttc
aggccaagtcctctatatagagcaagggctcttgaaaagcagcttgatactactgcaaga
atttattataaatatgaagggacgaatgctaccgggagccacaagcttaattctgcaata
ccccaggtatattacaataagctggcaggtattaaaagacttgcaactgaaacaggggct
ggtcaatggggcagtgctttaagtcttgcaacaagccaatttgggttggaatgttctgtt
tatatggttaatgtaagctatcagcagaagccttataggcgttcttttatgaaaaccttt
ggtgcaaatgttgtagcaagtcccagcacactaacaaacagtggacggagtattttagag
atagaccctgattgttcgggcagtcttggaatcgcaataagtgaggcggttgaggatgca
gcaacacacgcagataccaattatgcattgggaagtgttttaaaccacgtctgcctgcat
cagactataatcggtattgaagcaaaaaagcaaatggaatatttagatgaatatcccgat
gtaatttttgcttgctgcggaggcggaagcaattttgcaggtatagccttcccgttttta
caggataagctgaacggacataatttaagagctgttgctgttgaaccgtcagcatgtcct
actttgacaaagggtgtgtttgcatacgattacggagatactgcaaaagcagctccaata
acaaaaatgtatactttaggacatgactttattccctccggtatacatgcaggcggcttg
aggtaccacggaggctccgcaattgtcagccagctgtaccatgatggaatcattgaagca
aaagcgtacggtcagaagtctgtttttgaagcggcagtagcctttgcacgtgcagaggga
attgttcctgctcctgaatcggcacatgctataagggctgcaatggatgaagctatcctg
gcaaaggaatctggcgaggaaaaggttattctgttctgtctcagcggacacgggtacttt
gattttgcggcgtatgaaaactactttagcggactgattgatgatatagaattttcccct
gaatctactaaaaagagtttacaggatttaccaaacataaaatag

DBGET integrated database retrieval system