KEGG   Clostridium cellulolyticum: Ccel_2595Help
Entry
Ccel_2595         CDS       T00835                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ccel_2595
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ccel_2595
Exosome [BR:cce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccel_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3130283..3131779)
Genome map
AA seq 498 aa AA seqDB search
MQKRYVLALDQGTTSSRAVIFDSLSGNIAGIKNLPLQQFYPRPGWVEHDADDIFRDQMSA
INGAIKMAGINTESIACIGITNQRETVVVWDRNTGKPVHRAIVWQCRRSSEICDSLKTAG
LRDKIKSKTGLVIDAYFSGTKIKWILDHVEGAREKAQRGELLAGTIDSWLIWNLTGGRKH
ITDYSNASRTMLYNINDLKWDDELLGELGIPACMLPEVVSSSGVCAYTHEKILGERIPIS
GIAGDQHASLFGQACFKRGDAKNTYGTGCFILMNTGKTPVVSKNNLITTIAWGIDSEVEY
ALEGSVFNAGAAIQWLKDELGIIKTAHESDIEAKKVPDTGGVYVVPAFTGLGAPYWDMYA
RGTILGLTRGTNKRHIIRATLESIAYQCRDVLEAMKLDSGIELNALKVDGGVSASNFLMQ
FQADVLNISVQRPVIRETTALGSAFLAGLGVGIWTSKEEIEQAWNLDKAYMPGENKKYYD
SLYLRWKKAVEKSMKWDI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagagatacgttttagccttggatcagggaactaccagttcaagagcagtaata
ttcgacagcttgagcggtaatatagccggaataaagaatttgccgctgcaacagttttat
cctcggcccggatgggttgagcatgatgcagatgatattttcagggaccagatgtctgcc
ataaacggagcaataaaaatggccggaataaatactgaatcaatagcctgcatagggatc
acaaatcagagggagactgtagttgtctgggacagaaatacgggaaaaccggtgcataga
gccattgtgtggcagtgcagaagaagctctgaaatatgtgacagtttaaagacggctggc
ttgagggataaaataaaaagtaaaaccgggctggtaatagatgcatacttttctggaaca
aagattaaatggattctggatcatgtagagggagcgagggagaaggctcaaagaggagag
ctgctcgcaggaaccatagattcgtggcttatctggaatttaaccggaggcagaaaacac
attacggattattcgaatgcatccagaaccatgttgtataatataaatgatttaaaatgg
gacgatgaactactgggggaactgggaattccggcgtgtatgctgccggaggtagtatca
tcatccggggtatgtgcatacacccacgagaaaattttaggtgagagaattccgatttcg
ggaatagccggtgatcagcatgcttctcttttcgggcaggcatgctttaagcggggtgat
gccaaaaatacctatggtacgggttgttttattttaatgaataccggcaagacacctgtt
gtttcaaaaaacaatttaataactactattgcatggggcatagacagtgaagtggaatat
gcacttgagggcagtgtatttaatgccggagcggcgattcagtggttgaaggatgagctt
ggtataatcaagactgcacatgaaagtgacattgaggcaaaaaaagttcccgatacgggt
ggagtatatgttgttcccgcatttacaggtttaggagcaccatactgggatatgtacgcc
cggggtacaattctggggttaaccaggggtactaacaaaagacatattataagagctact
ctggagtccattgcatatcagtgcagggatgtacttgaagccatgaagctggattcgggg
atagaactcaatgcactaaaggtagacggaggtgtaagtgcaagcaactttcttatgcag
tttcaggcagatgtcctgaatatatctgtccaaagacctgtgataagggaaacaacggca
ctcggctcagcatttctggcaggacttggtgtggggatatggacatcaaaggaagaaata
gaacaggcatggaatcttgacaaggcatacatgcccggtgaaaataaaaaatactatgac
agtctatacttaaggtggaagaaagctgttgaaaaatcaatgaaatgggatatttag

DBGET integrated database retrieval system