KEGG   Clostridium cellulolyticum: Ccel_2612Help
Entry
Ccel_2612         CDS       T00835                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccel_2612
   01230 Biosynthesis of amino acids
    Ccel_2612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccel_2612
   00030 Pentose phosphate pathway
    Ccel_2612
   00051 Fructose and mannose metabolism
    Ccel_2612
   00052 Galactose metabolism
    Ccel_2612
  Energy metabolism
   00680 Methane metabolism
    Ccel_2612
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ccel_2612
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ccel_2612
Protein phosphatases and associated proteins [BR:cce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ccel_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3146030..3147013)
Genome map
AA seq 327 aa AA seqDB search
MSDIKTIGVLTSGGDAPGMNAAIRAVVRTGIYYGLKMLGIRKGYNGLVTGDIFDMSARDV
SDIIHRGGTILQTARCKAFTTDEGMQKAMSISKAFGIDAIVTIGGDGSYRGARDFSKFGM
KVMGLPGTIDNDIASSEYTIGYDTAMNTVQDALDKIRDTAYSHERCSVLEVMGRRAGHIA
LNVGIAGGAEVILLPEREFDFDKDIIRKIIQGRNNGKKNYIIILAEGVAEKIGGALELSK
KIEDLTGIETRGTVLGYIQRGGSPTIQDRVMASVMGAKAVKLLKDGVYNRIISVKDSKVI
DLDIDEALAMKKDIDNDLLELSNVLSI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcaaaacaataggagtacttaccagcggaggagacgcaccgggaatgaat
gctgcaatacgtgccgttgtgagaacaggcatatattatggtttaaaaatgctgggcata
agaaagggttataacggtttagttaccggagatatatttgatatgagtgccagagatgta
tcagatataattcatcgtggaggaacgatacttcagactgccagatgtaaggcatttaca
actgatgaaggcatgcagaaagcaatgtctatttcaaaagcctttggtatagatgcaatt
gttacaatcggaggagacggttcatatagaggagccagggatttcagcaaatttggtatg
aaggttatgggcctgccgggaacaattgataatgacatagcaagttcagaatatacaata
ggttatgatacagcaatgaataccgttcaggatgcacttgataaaatcagagatacagca
tactcacatgaacgatgcagtgtgctggaagttatgggacgccgtgcaggacacattgcc
ctgaatgtaggtattgcaggaggtgcggaagtaattctgcttccagaaagagagtttgat
tttgataaggatattatcaggaaaataatacaggggagaaataacggaaagaaaaactat
ataatcatactggccgaaggcgtcgctgagaaaataggaggggcattggagctttccaag
aagatagaggaccttacgggtatagaaacaaggggaaccgttttgggatatattcaaaga
ggaggaagcccgactattcaggacagagttatggccagtgttatgggggcaaaggctgta
aaattgctaaaagacggtgtttataacagaatcatatccgtcaaggattcaaaagttatt
gatttagatatagatgaagctttagcaatgaagaaagatattgacaatgatcttcttgaa
ctaagcaacgtactttcaatataa

DBGET integrated database retrieval system