KEGG   Clostridium cellulolyticum: Ccel_2877Help
Entry
Ccel_2877         CDS       T00835                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cce  Clostridium cellulolyticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cce01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cce00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3429533..3430351)
Genome map
AA seq 272 aa AA seqDB search
MCFKRQRLQDAQRIVIKVGTSTLTYETGKINFNCIDKLARIISDLSNQGKEVILVTSGAI
GVGVDKLKLSERPKTIREKQAVAAVGQCELMHMYSKFFSEYGHIVAQILLTRDIMGDEKC
RKNVVNTFETLLEKGIVPIVNENDSVSTVELKVGQKDTFSENDTLSAIVSKLIEADLLII
LSDIDGFYDSDPRKNPDSRMLSVIDKITPEIEDCAEGAGTKRGTGGMVTKLSAAKIATGA
GVDVVLTNGSHPEAILDILSGEQVGTLFIGSK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttcaaaagacagaggcttcaggacgcacagaggattgtcattaaagtaggaact
tctactttgacatatgagaccggaaaaattaattttaattgcatagataagctggcaaga
attatttctgatttatcaaatcagggcaaagaggtaatactggttacttcaggagctatc
ggcgtaggtgttgataaactcaaattatctgaaaggcctaaaaccataagggagaagcag
gctgtggcagctgtaggccagtgtgaacttatgcatatgtacagtaagttcttttctgaa
tacggacacattgttgctcagattctcttgacaagagatataatgggggatgaaaaatgc
cgcaagaatgttgttaatacctttgaaactcttttggaaaagggcattgtccctatagta
aatgagaatgactctgtttctacagttgagcttaaagtcggacaaaaagataccttcagc
gaaaacgatacactgtccgctattgtttccaagcttattgaggctgatttacttataatt
ttatcggatatagacgggttttacgattctgacccacgtaaaaatccagactctagaatg
ttgtcggttatagataaaataactcctgagattgaggattgtgccgagggtgcgggaacc
aaacgaggcaccggaggaatggttacaaagctcagtgctgcaaagatagctacgggtgcg
ggagtagatgtagtactgacaaacggaagtcatcctgaagcaattctcgatattttaagc
ggagaacaggttggtacgttattcatcgggtcaaaatag

DBGET integrated database retrieval system