KEGG   Clostridium cellulolyticum: Ccel_3216Help
Entry
Ccel_3216         CDS       T00835                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cce  Clostridium cellulolyticum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cce01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cce00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3752395..3753177
Genome map
AA seq 260 aa AA seqDB search
MILDKIAASTKIRVENLKKEVSFSFVKSEASKLVNKSPFAFEKAVKDGELTFICEIKKAS
PSKGLISENFPYIDIAKDYEAAGAGAISVLTEPEFFLGSDQYLKDVKKTVSIPVLRKDFT
IDPYQIYEAALIGADCVLLICALLDTDTLKEYIKIADGLGLSCLVEAHDENEVKSAIEAG
SRIVGVNNRNLKTFEVDITNSIRLRELVPSDISFVSESGIRTAQDISALRRIGASAVLIG
ETLMRSGDTGAELAKLRGSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattctggataaaatagccgctagtacaaaaatacgtgttgagaatctaaaaaaggaa
gtgtcttttagttttgtaaaatctgaggcatcaaaattggtaaacaagagtccttttgct
tttgaaaaagcagtaaaggatggtgagcttacttttatatgcgagataaaaaaagcatcc
ccttcaaaagggcttatttctgaaaattttccttatattgatatagccaaagattatgaa
gctgccggagccggagcaatctctgttttgacagaacctgaattttttcttggcagtgac
caatatttgaaagacgttaaaaaaacagttagtattcctgttcttagaaaagattttact
attgacccgtatcagatttatgaagccgccttaataggtgcggactgtgtactgcttata
tgtgccttgctggacactgataccttgaaagagtatataaagattgcagatggccttgga
ctgtcctgtcttgtagaggcccatgatgaaaatgaagtaaaaagtgcaattgaagcgggc
agcaggattgttggcgttaacaacaggaatctgaaaacctttgaggttgatataaccaac
agtattcgacttagagaacttgtaccctctgatataagctttgtatcggaaagcggtatt
cgtactgcccaagatatttcagcacttcgcagaattggtgcaagtgccgttctcattgga
gaaacccttatgagaagtggtgatacgggtgcagaactggcaaagctccgggggtctgca
taa

DBGET integrated database retrieval system