KEGG   Clostridium cellulolyticum: Ccel_3218Help
Entry
Ccel_3218         CDS       T00835                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00260  Glycine, serine and threonine metabolism
cce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01130  Biosynthesis of antibiotics
cce01230  Biosynthesis of amino acids
Module
cce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_3218
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_3218
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ACL77508
JGI: Ccel3218
UniProt: B8I0V2
Position
3753825..3755009
Genome map
AA seq 394 aa AA seqDB search
MIKGRYGKHGGQYIPEILMNTINELEESYNYYRNDFDFNRELNTLLKEYAGRPSLLYFAK
KMTEDLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKKMGKKRVIAETGAGQHGVATATA
AALMGLDCEIFMGLEDTKRQALNVFRMELLGAKVHPVTSGTQTLKDAVNETFREWASRMD
DTAYVLGSVMGPHPFPTIVRDFQSVIGKEVREQMLEKEGRLPDVAMACVGGGSNAMGLFY
DFIGDKSVELIGCEAAGKGVDTELHAATIAKGQLGIFHGMKSYFCQDEYGQIAPVYSISA
GLDYPGIGPEHANLHDTSRAKYVPITDAEAVTAFEYLSRTEGIIPAIESSHAVAHAMKIA
PKMENDKIIVICLSGRGDKDVAAIAKYMGVNIDE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaggcagatatggaaagcatggggggcaatatatccctgaaatattaatgaac
accataaatgaacttgaagagagttataactattatagaaatgattttgacttcaacagg
gagcttaataccttattgaaggaatacgcaggaaggccctccctgttatatttcgcaaaa
aaaatgacagaggatttgggtggtgcaaaaatatatctaaagcgtgaagacctgaatcac
acaggttcccacaagataaacaatgttctgggacaggtgcttctggcaaagaaaatgggc
aaaaagcgtgtcatagccgagacaggtgctggacagcacggtgtggctactgcaaccgct
gcggcacttatgggtcttgattgcgaaatttttatgggtctggaggatactaagcgtcag
gcgttaaatgttttcagaatggagctgctgggtgcaaaagtccacccggttacaagcgga
acacaaaccttgaaggacgcagttaatgagactttccgtgagtgggcttcaagaatggat
gacaccgcctatgtactgggttctgttatggggcctcatccatttcctacgattgtaaga
gatttccagagtgttattggtaaggaagtcagggaacagatgttggagaaagaaggcagg
ctcccggatgttgccatggcttgcgttggcggcggcagtaatgctatgggacttttttat
gactttataggcgacaaatccgttgagctgataggatgtgaagccgccggaaaaggtgta
gatactgaattgcatgcagctactatagcaaaaggacagcttggaatattccacggtatg
aaatcgtatttttgtcaggacgaatacggacaaattgctcccgtttactctatttcggca
ggcttggattaccccggaataggtcccgaacatgcaaacctccatgacacgagccgtgct
aaatatgtccccataactgatgcagaggcggttacagcctttgaatatctttcacgtacc
gaaggtatcattccggcaattgaaagctcccatgcagttgcacatgccatgaaaattgca
cctaaaatggaaaatgacaaaataatagttatttgcctttcaggaagaggagataaggat
gttgctgctattgcaaaatatatgggggtgaatattgatgagtaa

DBGET integrated database retrieval system