KEGG   Clostridium cellulolyticum: Ccel_3219Help
Entry
Ccel_3219         CDS       T00835                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_3219
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_3219
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_3219
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3755002..3755772
Genome map
AA seq 256 aa AA seqDB search
MSKISNAFKNGKAFIAFLTAGDPSLEKTEEFVLEMVKAGADLIEIGIPFSDPIAEGEVIQ
RANLRALSTGTTMDKVFDTVKRIRQKTQVPLVFLTYLNPVFTYGYDHFFRECSEHGVDGV
IIPDIPFEEKGELMPFSDKYNVDIISLIAPTSEERISKIASASKGFVYCVSSKGVTGVRN
EIKTDLQSIVSSVRSATKVPVAVGFGISTPQQASEIVKYADGIIVGSAIVKIIEQNGNNA
AAPLYDYVLNMKKYII
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagtaatgcatttaaaaacggtaaggcatttatagcctttcttacagca
ggtgacccttccttagaaaagaccgaggaatttgttctggaaatggttaaagcaggtgct
gaccttattgaaataggtattccattttcagaccctatcgcagagggcgaggtcattcaa
agggcaaacctacgagcattatcaacaggaacaactatggataaagtttttgatacagtt
aaaagaatcagacaaaagacccaagttccacttgttttcctaacctatcttaaccctgta
tttacctacggttatgaccactttttcagagaatgcagcgaacatggtgttgacggcgtt
ataattcctgatatcccatttgaggaaaaaggtgagctgatgccatttagtgataaatat
aatgttgatattatttctttaattgcacctacttctgaggaacgtatcagtaaaatagca
tccgcctcaaaaggttttgtctactgtgtatcctcaaagggagtcacaggtgtacgcaat
gaaattaaaacagacctgcagtcaattgtatcctctgtcaggtctgcaacaaaagtccct
gtggctgtaggctttggtatatccacccctcagcaggcatcagagattgttaaatatgcc
gatggtattattgtgggaagtgctattgtaaaaattatcgaacaaaacggtaataatgcc
gcggcacctttatacgattatgtcttgaatatgaaaaagtatataatataa

DBGET integrated database retrieval system