KEGG   Clostridium cellulolyticum: Ccel_3219Help
Entry
Ccel_3219         CDS       T00835                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cce  Clostridium cellulolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccel_3219
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccel_3219
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_3219
Enzymes [BR:cce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccel_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3755002..3755772
Genome map
AA seq 256 aa AA seqDB search
MSKISNAFKNGKAFIAFLTAGDPSLEKTEEFVLEMVKAGADLIEIGIPFSDPIAEGEVIQ
RANLRALSTGTTMDKVFDTVKRIRQKTQVPLVFLTYLNPVFTYGYDHFFRECSEHGVDGV
IIPDIPFEEKGELMPFSDKYNVDIISLIAPTSEERISKIASASKGFVYCVSSKGVTGVRN
EIKTDLQSIVSSVRSATKVPVAVGFGISTPQQASEIVKYADGIIVGSAIVKIIEQNGNNA
AAPLYDYVLNMKKYII
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagtaatgcatttaaaaacggtaaggcatttatagcctttcttacagca
ggtgacccttccttagaaaagaccgaggaatttgttctggaaatggttaaagcaggtgct
gaccttattgaaataggtattccattttcagaccctatcgcagagggcgaggtcattcaa
agggcaaacctacgagcattatcaacaggaacaactatggataaagtttttgatacagtt
aaaagaatcagacaaaagacccaagttccacttgttttcctaacctatcttaaccctgta
tttacctacggttatgaccactttttcagagaatgcagcgaacatggtgttgacggcgtt
ataattcctgatatcccatttgaggaaaaaggtgagctgatgccatttagtgataaatat
aatgttgatattatttctttaattgcacctacttctgaggaacgtatcagtaaaatagca
tccgcctcaaaaggttttgtctactgtgtatcctcaaagggagtcacaggtgtacgcaat
gaaattaaaacagacctgcagtcaattgtatcctctgtcaggtctgcaacaaaagtccct
gtggctgtaggctttggtatatccacccctcagcaggcatcagagattgttaaatatgcc
gatggtattattgtgggaagtgctattgtaaaaattatcgaacaaaacggtaataatgcc
gcggcacctttatacgattatgtcttgaatatgaaaaagtatataatataa

DBGET integrated database retrieval system