KEGG   Clostridium cellulolyticum: Ccel_3407Help
Entry
Ccel_3407         CDS       T00835                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00040  Pentose and glucuronate interconversions
cce00052  Galactose metabolism
cce00500  Starch and sucrose metabolism
cce00520  Amino sugar and nucleotide sugar metabolism
cce01100  Metabolic pathways
cce01130  Biosynthesis of antibiotics
Module
cce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ccel_3407
   00052 Galactose metabolism
    Ccel_3407
   00500 Starch and sucrose metabolism
    Ccel_3407
   00520 Amino sugar and nucleotide sugar metabolism
    Ccel_3407
Enzymes [BR:cce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ccel_3407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ACL77695
JGI: Ccel3407
UniProt: B8I1R0
Position
complement(3958886..3959758)
Genome map
AA seq 290 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAQPKEMIPIVDKPTIQYIVEEAVAAGIEDILIISGRNK
RAIEDHFDKSYELEEELHRKGKLDLLSVVQEISNIANIHYIRQKEAKGLGHAIYCAKSFI
GNEPFAVMLGDDIVDSPVPCIKQLMDVYNEYQTTILGVQKVPLQDVTKYGVIGGTQIDES
VYKVKGLVEKPEVEQAPSNIAILGRYIISPRIFEFLETAVPGKNGEIWLTDALQKLMEQE
AMYAFDFAGDRYDVGDRIGFLKATVEFALKREDLKDDFTAFLRHKMEQLP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacgaaaggcgataatacctgctgccggtcttggaactaggtttttacctgca
accaaggcacagcctaaggaaatgatacctatagttgataaacccactatacaatatatt
gttgaagaagcagttgccgcggggattgaagatatacttatcatctccggaaggaataaa
agggcaattgaagaccattttgacaaatcctacgaattggaagaggagcttcatagaaag
ggaaaactggatttgttaagtgtggttcaggagatttcaaatattgcaaatatacactat
ataaggcagaaggaagcaaaaggcctgggacatgctatttactgtgctaaatcatttatt
gggaatgaaccttttgcagtcatgctgggtgacgatatagtggattctccggtaccgtgt
atcaagcagctgatggacgtatataatgaataccagactactattctgggagtacagaaa
gtaccccttcaggacgtcacaaaatatggtgttattgggggaacacagatagacgaaagc
gtctataaggtaaagggattagttgagaaaccggaggtagagcaggcaccatccaacata
gctatattgggaagatatattatatctccaaggatttttgaattcctggaaacagcagta
ccgggtaaaaatggagaaatttggctcacagacgcactccagaagctgatggagcaggaa
gcgatgtatgcctttgattttgcaggtgatagatatgatgttggagacagaattggcttc
ctaaaggctacggttgaatttgctttaaaaagagaggacctgaaggacgattttacagcc
tttttgaggcataaaatggagcagcttccgtaa

DBGET integrated database retrieval system