KEGG   Clostridium cellulolyticum: Ccel_3426Help
Entry
Ccel_3426         CDS       T00835                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00052  Galactose metabolism
cce00561  Glycerolipid metabolism
cce00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ccel_3426
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ccel_3426
   00600 Sphingolipid metabolism
    Ccel_3426
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ccel_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACL77714
JGI: Ccel3426
UniProt: B8I1S9
Position
complement(3987858..3989183)
Genome map
AA seq 441 aa AA seqDB search
MVKITFMGAGSTVFAKNVLGDSMCSEALADCEIRLYDIAGDRLKESQIMLEAINRNINGG
RAKIKTYLGVENRKEALRNADFIVNAIQVGGYDPCTIIDFEIPKKYGLRQTIADTLGIGG
IMRTLRTIPVLEDFARDIEEVCPNAWFLNYTNPMAMLTGYMQRFTGVKTIGLCHSVQVCS
QDLMKSLGMEDRLEGRKELIAGINHMGWLLEICDKNGNDLYPEIRRRAKEKNQNEKHSDM
VRYEYIDKLGYYCTESSEHNAEYNPFFIKSSYPELIDKFNIPLDEYPRRCIEQIQEWNKR
RDELMNNEYLTHERSNEYASYIMEAIVTNKPFKIGGNVINKGGLIENLPHEACVEIPCMV
DGMGINPCRVGRLPVQLAAMNMTNINVQLLTIEAAATRKKEHIYHAAMLDPHTSAEMTLD
NIVKMVDELIEAHGSWLPKFK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaataacatttatgggagccggtagtactgtatttgcaaaaaatgtactgggt
gacagcatgtgttcggaagctctggcagactgtgagataaggctgtatgacatcgcaggt
gatagactcaaggagtctcaaataatgctggaagcgataaatagaaatataaacggggga
agggctaaaataaaaacctatctaggggtcgaaaacagaaaggaagccctccgaaacgct
gattttattgtaaatgcaattcaagtgggaggatatgacccttgtacgattattgatttt
gagattcccaaaaagtatggattaagacaaacaatagcagatacattaggaatcggtgga
ataatgcgtacacttaggacaataccggttttggaggactttgcaagggatattgaagaa
gtttgtcctaatgcatggttcctgaattatacaaatcctatggctatgttgaccggatat
atgcagagatttaccggtgtaaaaacaataggactatgccacagtgtacaagtttgctca
caggatttgatgaagtccctgggcatggaagaccgattggaaggaagaaaggaattgata
gcaggtataaaccatatgggatggctgctggagatatgcgataagaacggtaatgacctt
taccctgagattagaaggcgtgcaaaagaaaagaatcaaaatgaaaagcatagtgacatg
gtgagatatgagtatatagataaactggggtattactgcactgaatcaagtgaacacaac
gctgaatacaatcccttttttatcaaatcctcatatcctgaacttatagataagtttaac
atacctcttgatgaatatccgaggagatgcatagaacagattcaagaatggaataaacgc
agggatgaattaatgaataacgaatacctcactcatgagagatcaaatgagtatgcatcc
tatattatggaagctattgttaccaataagcccttcaaaataggcggaaacgttattaat
aaaggtggtcttattgagaaccttccacacgaggcgtgtgttgaaataccttgtatggtt
gatggaatggggattaatccatgtagagtggggcggttgcctgtacaattggcagcaatg
aatatgactaacatcaacgtccagcttttaactattgaagcagcagccactagaaagaag
gagcacatttaccatgcagcaatgctggatccgcacactagtgctgaaatgactcttgat
aacatagtgaaaatggttgatgaactaatagaggcacatggcagttggcttccgaaattt
aaatag

DBGET integrated database retrieval system