KEGG   Clostridium cellulosi: CCDG5_1664Help
Entry
CCDG5_1664        CDS       T03806                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ccel  Clostridium cellulosi
Brite
Translation factors [BR:ccel03012]
 Eukaryotic Type
  Elongation factors
   CCDG5_1664 (tuf)
 Prokaryotic Type
   CCDG5_1664 (tuf)
Mitochondrial biogenesis [BR:ccel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CCDG5_1664 (tuf)
Exosome [BR:ccel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CCDG5_1664 (tuf)
  Exosomal proteins of breast cancer cells
   CCDG5_1664 (tuf)
  Exosomal proteins of colorectal cancer cells
   CCDG5_1664 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1775898..1777100)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERNKPHINIGTIGHVDHGKTTLTAAITKVLGFKGKAEYMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
VLARQVGVPYIVVYMNKTDQVDDPELLELVEMEIRDLLTKYEFPGDEVPIIKGSALQALE
CTSTDINAPEYKSILELMDAVDKYIPTPERKDDQPFLMPVEDVFTITGRGTVATGRVERG
TVKLGEEVEIVGLTTERKKTVITGLEMFRKTLDFAEAGDNIGALLRGIQRNEIERGQVLC
KPGSIHPYTKFTGQVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGVITLPEGTEMCMPG
DNVTMNVELITPIAIEVGLRFAIREGGRTVGSGMVTAVYD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagtttgagagaaacaaacctcacattaatatcggtacgattggtcac
gttgaccatggtaagacaaccctgaccgctgctatcacaaaggttctcggtttcaagggc
aaagctgagtatatggcttatgaccagatcgataaggctcctgaagagagagagcgcggt
atcacaatcaacaccgctcatgttgagtacgagacagatgcaaggcattatgcacacgtt
gactgcccgggtcatgctgactatgttaagaacatgatcactggtgctgctcagatggac
ggcgctattctcgtcgtttccgctgctgacggtcctatgccgcagactcgtgagcacatc
gttcttgctcgtcaggtcggtgtaccgtatatcgtcgtttatatgaacaagactgaccaa
gtcgacgatcctgagctgcttgagctcgttgaaatggaaattcgtgacctgctcacgaag
tacgagttccctggcgacgaagtcccgatcatcaagggttcagctctccaggctctcgag
tgcacatcaacagatatcaatgctcctgaatacaagagcattctcgaactgatggatgca
gttgataagtatatcccgactccggaacgtaaagacgaccagccgttccttatgcctgtt
gaagacgtattcaccatcacaggccgtggtactgttgctacaggccgtgttgagcgtggt
actgtcaagctcggtgaagaagttgagattgtcggtcttacaacagagcgcaagaagact
gttatcacaggtcttgagatgttccgtaagactcttgacttcgcagaagccggcgacaac
atcggtgcacttctccgtggtattcagagaaatgaaatcgagcgtggacaggttctctgc
aaacctggatcaattcatccgtatacaaagttcactggccaggtttacgtcctgactaag
gaagagggcggccgtcatactccgttcttcaacaactacagaccgcagttctatttccgt
acaacagacgttactggtgtcatcactctgccggaaggcactgagatgtgcatgcctggc
gacaatgttaccatgaatgttgagctcatcactccgattgctatcgaagttggtctgcgt
ttcgctatccgtgaaggcggacgtacagtaggctcaggtatggtaacagctgtttatgac
taa

DBGET integrated database retrieval system