KEGG   Corynebacterium casei: CCASEI_02725Help
Entry
CCASEI_02725      CDS       T03041                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccg  Corynebacterium casei
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCASEI_02725
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCASEI_02725
  Energy metabolism
   00680 Methane metabolism
    CCASEI_02725
Enzymes [BR:ccg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CCASEI_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(556873..559647)
Genome map
AA seq 924 aa AA seqDB search
MSEQVRDDIRLLGRILGRVIAEQEGEDVYELVESTRRLAFGVARGEEDAEALLSTFRDVD
ENKINLVARSFSHFALMANIAEDLDDESALAAREDSGEHAPDASLEGVLAKLKAADGVST
SEVTRVLDAALVSPVFTAHPTETRRRTVFDVQKRIIKLLRERHGILAQPQTPRRITRLAE
IEREAHLRMTILWQTALIRIARPQIEDEVNVGLRYFKRSLLEQVPAINRDTIAGLRDVFG
GAVPNRQVVRTGSWIGGDHDGNPYVTGETLTYATRTAADTVLEYHVDQLGLLEKELSISD
RYSESSAELQELAARGNNDVPSRVDEPYRRAIHGVLGRMTATRASIAGDSVKDAAQDEVN
EFAPYSSPAEFKAELDIIDRSLRQFNDAIIADDRLLRIRSALDSFGFHLNALDLRQNSES
FEAVLDELFAGAGVTASGAGYKGLNEQAKRELLAAELTSARPLTFPWSATYSEVTERELG
IFRAAADAVDTLGVDVVPHCIVSMTGTVSDILEPMVLLKEVGLLSFDPARGRLVGSVDIA
PLFETIDDLKAGAKILQELWDVPLYRDYLRGRGDTQEVVLGYSDSNKDGGYLSANWALYD
AQLEIVEACNTHGIGLRFSHGRGGAVGRGGGPTYDAILAQPEGAVRGSVRITEQGEVISA
RYGTATTARRHLEAFVAGTLEASLLNTEKLKEPERAYSIMREISGLAGEKYASLVRHDEG
FIDYFTQSTPLHEIGDLNMGSRPTARKQTESIADLRAIPWVLSWSQSRVNLPGWFGVGTG
ITRWAGDDDARWDDLRTLYHAWPFFRSVLDNMAQVMGKASMDLAKIYSTLVDDIETSQRV
YNTIAEEYALTREVFHRITDHDSLMAGNERLERSVQRRYPNLLPLNAIQIELLRRYRAGD
DSFLVSKTIQVTMNGLATGLRTSG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggttcgcgacgatatccgcttgcttggtcgaatcctcggccgggttatc
gctgagcaggaaggcgaggacgtatacgagctggtggagtccacccgccggctcgcgttt
ggtgtggcgcgcggtgaggaagacgccgaggctttgctatcgacgtttcgcgatgtggat
gagaacaaaatcaatttggttgcgcgttcctttagccactttgcgctgatggcgaatatc
gcagaggacttggatgatgaatcggcattggcagcgcgcgaagactcgggcgagcatgct
cccgatgcctcattggaaggcgtgctggccaagctgaaggctgccgatggcgtgagcacc
agcgaagtcacccgcgtgctggatgcagcactggtctcccctgtctttactgcgcacccg
acagagacgcgacgacgcacggtctttgatgtgcaaaagcgcattatcaaactgctgcgc
gagcgccacgggattctggcacagccgcagacaccgcggcggattacgcgcctagctgag
attgagcgtgaggcgcacttgcgtatgaccatcttgtggcaaacagcgctaattcgaatt
gcccggccgcagattgaggacgaggtcaatgtgggtctgcgctatttcaagcgcagcttg
ctggagcaggtacctgcgattaatcgcgacacgattgcgggcctgcgagacgtttttggc
ggcgcagtgcccaaccgtcaggtggtgcgtaccggttcctggatcggcggtgaccatgac
ggcaatccgtacgtcaccggtgagacgctgacttatgccacgcgtacggctgcggacacg
gtgctggagtatcacgtggaccagctcgggttgttggaaaaggagctgagcatctccgat
aggtattcagaaagctctgcggaattgcaggagttagccgcgcgcggcaataacgacgtt
ccaagccgcgtggatgagccttatcgtcgcgctatccacggcgtgctggggcgcatgact
gcgacgcgagcaagtatcgcaggagacagtgttaaagacgcagctcaagatgaggtcaac
gaatttgcgccctatagctctccggcagagtttaaggccgagctggacatcattgaccgc
tcgctgcgccaattcaatgacgccatcattgccgatgaccgcctcctgcgtatccgctcc
gcgctggactctttcggtttccacctcaacgccttggatttacgccagaactcagagtcc
ttcgaggcggtgctggatgagcttttcgcgggagcgggtgtcactgcttctggtgctggc
tataagggcctgaatgagcaagccaagcgcgaactgttagctgctgaactgacttctgca
cgtccgctgaccttcccgtggtctgcaacctatagcgaggtgactgagagggaactgggg
atatttcgggcagcagcagacgccgtggacacgctcggcgtcgatgtcgtcccgcactgc
attgtctctatgacaggcacagtaagtgacattctggagccgatggtgttgctcaaggag
gttggcctgctgagcttcgatcctgcgcgcgggcgactggtgggttccgtggatatcgca
ccgctgtttgaaaccatcgatgacttgaaggccggcgcgaagattctacaggagctatgg
gatgtaccgctctaccgtgactatttgcgtgggcgcggagacacccaagaagttgttttg
ggctattcggactctaataaggacggcgggtatctttccgccaactgggcgctctatgac
gcgcagctggagattgttgaggcctgcaatacccacggtatcggtttacgtttctcgcat
ggccgcggtggcgctgtgggccgcggtggtggaccgacctatgacgccatcttggcacag
ccagaaggcgcagtgcgcggctcagtacgcatcaccgaacaaggtgaggtcatctccgct
cgctatggcacagcaaccactgctcgccgtcacttggaagcatttgtcgcgggcacgcta
gaagcctcacttttgaatacggaaaagctgaaagaaccagagcgtgcttatagcatcatg
cgggaaatttccgggctcgccggcgagaaatacgccagcctggtgcgccatgatgaggga
ttcattgactacttcacccagtccacaccgctgcatgagattggtgatttgaacatgggc
tcacgcccgacggcccgcaagcaaaccgagtccattgcagacttgcgtgcaattccgtgg
gtgttgtcatggtcgcagtcgcgcgtgaatcttcccggctggttcggtgtcggcaccggc
atcacgcgttgggctggcgatgatgatgctcgttgggatgacctgcgtacgctataccac
gcatggccatttttccgctccgtgctggataacatggcgcaggtcatgggcaaggcttcc
atggatttagcgaagatttactccaccttggttgatgatattgagacgtcgcagcgcgtg
tacaacaccatcgcggaagaatacgctcttacccgcgaggtcttccatcgcattactgac
catgattccctgatggccggcaatgagcgtctggagcgctcagtacagcgccgctaccct
aatctgctgccgcttaacgcgattcagattgagctgctgcgccgctaccgtgccggcgac
gactcattcctagtgtcgaagaccatccaagtcaccatgaacgggcttgccacgggattg
cgtacttcaggttaa

DBGET integrated database retrieval system