KEGG   Corynebacterium casei: CCASEI_03605Help
Entry
CCASEI_03605      CDS       T03041                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ccg  Corynebacterium casei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCASEI_03605
Enzymes [BR:ccg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CCASEI_03605
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CCASEI_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(738340..739980)
Genome map
AA seq 546 aa AA seqDB search
MTKPTTHRWYENSVFYQILVGVFNDTTGEGIGTLKGVEEKLDYLQWLGIDCIWLSPFYAS
PLRDDGYDIADYRAIHPDYGTMEDFDDLIEAIHARGMKLITDLALNHTSMDHRWFQESRK
DPHGPYGDYYVWGDDPNRYPEIRIIFTDTESSNWSFDEVRGQYYFHRFYKEQPDLNYDSP
AVHKEVLSLIDFWMDKGLDGFRLDAIPYLYERDGAGGESLPETLEFIEKLRAHVDEHYPD
AFMIAEANQPPAETREYFGNGDRVHMVFNFPLMPRLYQAVATSQASPIIEIMPDLLHLPP
GTQWGNFLRNHDELTLEMVSGPERELMYSSYLPDDSMRAHLGIARRLAPLMDHDRAKIEL
MYALMFGLPGAPFLYYGEELGMHDEPSLPDRYAVRTPMQWEPGPGAGFTTSDTPKLPIVG
GEGLSVSEQRHDPDSLLSFVHSLIAARKAHPELGIGNYESIDVAEPSLLAVTRTLKAEDR
VIPSDPISSAPLVCLYNFAPHPIAIPPQALAGVNGVGRVVIGSFDTAAEVHSGDALPGFG
FVWLTA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaccaaccactcaccgctggtacgaaaattctgtgttctaccaaatcctggtg
ggtgtcttcaacgacaccaccggtgaaggcattggcacgctcaaaggcgtggaagaaaag
ctcgactatctgcagtggttaggcatcgactgcatttggctttcccctttctatgcctcc
ccgctgcgcgatgacggctatgacattgcggattaccgcgcgattcatccggactacggc
accatggaagactttgatgacctcatcgaagctatccatgcccgcggcatgaaactgatt
acagacctagcactcaatcacacctccatggaccaccgctggttccaagagtcccgcaaa
gacccgcatggtccgtatggcgactactacgtgtggggcgatgacccgaaccgctatccg
gaaatccgcatcatcttcaccgacaccgaatccagcaactggagcttcgatgaagtgcgc
gggcagtactacttccaccgcttctacaaagagcaaccggacctcaactatgacagcccc
gctgtgcacaaagaggtgctctccctcattgatttttggatggacaagggcctcgatggt
ttccgccttgatgctattccttatctatatgaacgtgatggcgccggtggggagagtctc
ccggagacgctagaattcatcgaaaagctgcgtgcccacgttgatgagcactaccctgat
gctttcatgattgcggaagccaaccagccgcctgccgagacccgtgaatactttggcaac
ggcgaccgcgtacacatggtgtttaactttccgctaatgccccggctctaccaggcggtg
gccaccagtcaggcaagcccgattattgaaatcatgccggacttactgcatctaccacca
ggcacgcagtggggtaacttcctgcgcaaccatgatgagctcactctggaaatggtttcc
ggccctgagcgtgagctgatgtactcgtcttatcttcccgatgattccatgcgtgcgcac
cttggtattgcgcggcgtctggctccgttgatggaccatgaccgcgccaagattgaattg
atgtacgcgctgatgttcggcctgcctggtgcgccatttttgtactacggcgaagaacta
ggaatgcatgatgaaccatccctgcccgaccgctacgctgtgcgcacgccgatgcaatgg
gagcccggcccgggtgctggtttcaccacctccgatacaccgaagcttcctatcgtaggc
ggcgaaggcctgtccgtctctgaacagcgccacgacccggattccctgctgagcttcgtg
cactcgctgattgctgcgcgcaaggcgcatcctgaacttggcattggcaactatgaatcc
atcgacgtggctgagccttccctgcttgccgttacccgcacactcaaggctgaagaccgc
gttatcccttctgatccgataagctctgcgccgctggtgtgcctgtataactttgccccg
cacccgattgccatccctccccaagccctagctggcgttaacggcgtgggccgcgtggtc
atcggctctttcgacaccgccgccgaagtccactccggcgacgcactcccgggctttggc
tttgtctggctaacagcatag

DBGET integrated database retrieval system