KEGG   Corynebacterium casei: CCASEI_04040Help
Entry
CCASEI_04040      CDS       T03041                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ccg  Corynebacterium casei
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CCASEI_04040
   00650 Butanoate metabolism
    CCASEI_04040
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCASEI_04040
   00280 Valine, leucine and isoleucine degradation
    CCASEI_04040
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCASEI_04040
Enzymes [BR:ccg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CCASEI_04040
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CCASEI_04040
Amino acid related enzymes [BR:ccg01007]
 Aminotransferase (transaminase)
  Class III
   CCASEI_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
830907..832220
Genome map
AA seq 437 aa AA seqDB search
MKDFDYHLPQERRVVTDGMGEKSAEINARREAAIARALTPGLPGYVVTADGGVLVDADDN
SYIDFASGIAVTSVGASNKRVADAVSKAAAQFTHTCFMVSPYESYVAVCEKLNQLTPGDH
EKKSVLLNSGAEAVENAVKIARKYTGKNAVAVFDYGYHGRTNLTMSMTAKNKPYKTGFGS
LASDVHRVPMSYPARDGLKGDQAAARAIKVLDQQVGPENLACVVIEPVQGEGGFIVPAEG
FLPAIAQWCRDNDVVFIADEIQSGFGRTGQWFASENEQVIPDLVTTAKGIAAGMPLSGVT
GRAEIMDSPIPGSLGGTYGGNPVACAAALAAIEEFEAHDLPGRAREIEAIVREYFEPLLE
LESVLDVRGRGAMMAIELINAEVTNEIAAACKKQGILILTCGLDGNVIRLLPALTIPEHL
LREGLEILTTEIREALA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgattaccacctgccgcaggagcgtcgagtagtcactgatggaatggga
gaaaagagcgcggagattaatgcgcgccgtgaggcagccattgcccgtgccctgacccca
ggtctgcctggatatgtcgttactgcagatggtggtgtcctggttgatgccgatgacaac
tcatacatcgatttcgcatccggcattgctgtgacgtccgttggtgcttccaataagcga
gttgcagatgctgtgtctaaggctgccgcacaatttacccacacctgtttcatggtctcc
ccatatgagtcctacgtagcggtgtgtgaaaagctaaaccagctcaccccaggtgaccat
gagaagaagtccgttcttctaaactctggtgctgaggcagtagaaaacgcagtcaagatt
gcgcgtaagtacaccggcaagaatgccgtggcagtttttgactacggttaccacggccgt
accaacctgaccatgtccatgacggcgaagaacaagccttacaagacaggtttcggcagc
ttggcttccgatgtccaccgggtgccaatgtcctacccagcacgtgatggtctcaagggt
gatcaggcagcagcacgcgcaatcaaggtgctcgaccagcaggtcggacctgaaaacctg
gcgtgtgttgtcatcgagccagtccagggtgagggcggtttcatcgtcccagctgaaggc
ttcttgccagccattgcgcagtggtgccgcgataatgatgtcgtcttcatcgctgatgaa
atccagtccggcttcggccgaaccggccagtggttcgcgtctgagaacgagcaggtcatc
ccagacctggtgaccactgcgaagggtatcgctgctggtatgccactatctggtgtgact
ggccgtgcggaaatcatggacagcccaatcccaggctctttgggcggtacctacggcggc
aacccagttgcttgtgccgcagcgctcgcagcaatcgaagagtttgaggcccatgacctg
cctggtcgtgcacgtgaaatcgaagcaatcgttcgcgagtacttcgagccactgctcgaa
ttggaatccgtcctagatgttcgcggtcgcggcgccatgatggccattgagctcatcaac
gccgaggtcaccaatgagattgctgctgcatgtaagaagcagggcatcctcatcttgacc
tgtggtctggacggcaacgtcattcgtttgctgcctgcgttgaccatcccggagcacctg
ctgcgtgaaggtctggaaatccttaccacggaaatccgcgaggctctcgcctaa

DBGET integrated database retrieval system