KEGG   Corynebacterium casei: CCASEI_13820Help
Entry
CCASEI_13820      CDS       T03041                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ccg  Corynebacterium casei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCASEI_13820
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CCASEI_13820
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCASEI_13820
Enzymes [BR:ccg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CCASEI_13820
Exosome [BR:ccg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCASEI_13820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3037775..3038383
Genome map
AA seq 202 aa AA seqDB search
MIEGGAIDWTGHANQSAREIEEMQDFNASVDAAIEWVKTNSNWEETLLIVTADHETGYLS
GMNEPEDGKWNVMAGDSSTLPTHEWYSGNHTNQVVPFFFKGAGSEDIMSQVKGTDPVRGD
YIDNTDIAKLAKNTWWTNGSNTGGNDDDDKKPVASGSSNAFSGLAGAGIMAAVIGALVAL
AQSVGVVSIDTSAIDRLIRQFK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgagggcggcgccattgactggactggtcacgctaaccagtccgcgcgtgagatt
gaagaaatgcaggacttcaacgcttccgttgacgctgctatcgagtgggtcaagaccaac
tccaattgggaagaaaccctgttgattgttaccgctgaccacgaaaccggctacctctcc
ggcatgaatgagccagaagacggcaagtggaacgtcatggccggtgactcgtctaccctg
ccaactcacgagtggtactccggtaaccacaccaaccaggtagttcctttcttcttcaag
ggcgctggctctgaagacatcatgagccaggtcaagggcaccgacccggtgcgcggtgac
tacatcgacaacactgacatcgcaaagctagcgaaaaacacctggtggaccaacggcagc
aacaccggtggcaacgacgatgacgacaagaagcctgttgcttctggttccagcaacgct
ttctctggccttgcgggcgcgggcatcatggctgctgtcattggcgcgctggtagcactc
gcccaatccgtgggcgttgtctccattgacacctccgcgattgaccgtttgatccgtcag
ttcaagtag

DBGET integrated database retrieval system