KEGG   Chlorobium chlorochromatii: Cag_0050Help
Entry
Cag_0050          CDS       T00290                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cch  Chlorobium chlorochromatii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cag_0050
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cag_0050
Enzymes [BR:cch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cag_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
56323..57873
Genome map
AA seq 516 aa AA seqDB search
MTAMNCIPCCNNLPSLTVGAFITALQAVEVTEQAGACHMEHCITAVSSDSRDMIEGALFV
AVRGFCTDGHRFIESAIERGACIIVCEELPQSITHGCLYLRVIDARKALAHVAALFYGNP
AKQLRFIGVTGTNGKTTTSRIITEMLTAFAVPSGYIGTNLCRIGKRDIPLERTTPEAHEL
HALFALMVEAGCKAVVMEVSSHALLLQRVYGLRFDAALFTNLTQDHLDFHHTMQAYAEAK
QLLFDQLQPDGVAIVNTDDAYAPLMLQRVAPSQRVCCTLQANVPSVLQCPQYGQDFQAEV
RHASLAATEMELRFPKGETELLTVGLAGSYNVMNVLQAAATGYCLGLQPAAICRALAAVH
SVDGRMERVGRPNLPYQIFVDYAHTPDALQKALETLKALKGEEARLMVLFGCGGNRDRLK
RPIMGSIAASLADVVILTSDNPRDESPDAILDEIEQGMQGAAHQRIADRAEAIRTAISQL
QAGDVLLIAGKGHERYQEVAGKRTYFSDQEEVGRCL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgactgctatgaattgcattccatgctgcaacaatctcccatcacttacggtgggggcg
ttcattacggcactacaagctgttgaggttaccgaacaagcgggcgcgtgccacatggag
cattgcattaccgccgtaagcagcgattcgcgcgacatgatagagggggcgctttttgtt
gctgtgcgtggtttttgcaccgatgggcatcgttttattgagagtgccattgagcgtgga
gcgtgcattattgtttgcgaggagttgcctcaatccattacgcatggttgcctttatctc
cgtgtaattgatgcccgcaaagccttagcgcatgttgcggcacttttttatggtaaccca
gcaaagcagttgcgcttcattggagttacgggcaccaacggcaaaaccaccacgtcgcgc
attattaccgaaatgctgacggcgttcgctgttccgtcgggctacattggcaccaacctc
tgccgtattggcaagcgcgatattccgttagagcgcaccacgcccgaagcgcatgagctg
cacgctctttttgccttaatggtagaagcgggttgtaaggctgttgtaatggaggtttcc
tctcatgcgttgctcttgcagcgtgtttatggcttacgttttgatgcagcactctttacc
aacttaacgcaagatcacctcgattttcaccacaccatgcaagcctatgctgaagccaag
cagttgcttttcgatcagcttcagcccgatggcgttgccattgttaatactgatgatgcg
tatgcgcccctcatgcttcagcgagttgcgccctcacagcgagtttgctgcaccttgcag
gcgaatgtgccgtcagtacttcaatgtccccaatatggacaagactttcaagccgaggtt
cggcacgcaagccttgcggcaaccgagatggagctacgctttccaaagggcgaaacagag
ttgctcacggttggtttagcgggcagttataatgtgatgaatgtgctgcaagccgcagcc
acaggctattgcttggggcttcaaccagccgcaatctgccgagcacttgctgccgtgcat
agcgttgatgggcgtatggagcgcgttggtcgtccgaatttgccctatcaaatctttgtg
gattatgcgcatacgcccgatgcgttgcaaaaggcgcttgaaactctgaaagcgcttaaa
ggtgaagaggcgcgtcttatggtgctttttggatgcgggggcaatcgcgatcgcttaaag
cgtccaattatgggaagtattgccgcctcgttagccgatgtggttattcttacctccgat
aatccgcgcgatgaatcacccgacgctattcttgatgaaattgagcaaggaatgcagggt
gcagcgcatcagcgcattgctgatcgggcagaagctattcgcacggctatcagccaattg
caagcaggtgatgtgcttttaattgcgggcaaagggcacgagcgctatcaagaggttgcg
ggtaagcgtacctatttttctgaccaagaagaggttgggcgctgtttatga

DBGET integrated database retrieval system