KEGG   Chlorobium chlorochromatii: Cag_0137Help
Entry
Cag_0137          CDS       T00290                                 

Definition
1-acyl-sn-glycerol-3-phosphate acyltransferase (EC:2.3.1.51)
Orthology
K00655  
1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cch00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cch00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(150909..151619)
Genome map
AA seq 236 aa AA seqDB search
MNFGTILFFLVLIPVMFAGMSLWLLISFFDKQGDIFHRIAAWWGGFSAKLFGIKIEVIGS
ENYNPAQHYLVVSNHAGMADIPLLLGCMKLNLRFLAKEELGRVPIFGTALRRSGYVMIKR
GQNREAMQSLLAAAEVLKSGRSVHIFPEGTRSATGELLPFKRGAFLVAIKGGAPVLPVTI
IGSHLITPKNSVKVNRGTIRLIIGKPIDPTQFNSAESLKNACAEVITEAFQRYRFN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcggtaccattttattttttcttgtactgattcctgtaatgtttgcaggaatg
tcgctatggctacttattagctttttcgacaaacaaggcgatatttttcaccgcattgct
gcatggtggggaggctttagcgcaaagctctttggcattaaaattgaggttattgggagt
gaaaattacaatccagcacaacattacttggtagtcagcaatcatgcgggcatggctgat
attccgttgctgttgggttgtatgaagctcaatttgcgatttcttgctaaggaggaactt
ggcagagtaccaatttttggtacagcgttgcgccgctcgggctacgtaatgattaagcga
gggcaaaaccgtgaagccatgcaaagcttgcttgctgcggctgaagtgttaaaaagcggg
cgatccgtccacattttccctgaaggtactcgctcagcaacgggcgaattactccctttt
aaacgaggcgcatttttagttgccataaaaggtggggctcccgttttaccggttaccatt
attggtagccacctgattactccaaaaaatagcgttaaagtaaatcgtggaactattcgc
ttgattattggcaaacctattgatcctacccaattcaatagtgctgaatcgctaaaaaat
gcttgcgcagaagtgattacagaggcgtttcagcgctataggtttaattga

DBGET integrated database retrieval system