KEGG   Chlorobium chlorochromatii: Cag_0137Help
Entry
Cag_0137          CDS       T00290                                 

Definition
1-acyl-sn-glycerol-3-phosphate acyltransferase (EC:2.3.1.51)
Orthology
K00655  
1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cag_0137
   00564 Glycerophospholipid metabolism
    Cag_0137
Enzymes [BR:cch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Cag_0137
Lipid biosynthesis proteins [BR:cch01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Cag_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(150909..151619)
Genome map
AA seq 236 aa AA seqDB search
MNFGTILFFLVLIPVMFAGMSLWLLISFFDKQGDIFHRIAAWWGGFSAKLFGIKIEVIGS
ENYNPAQHYLVVSNHAGMADIPLLLGCMKLNLRFLAKEELGRVPIFGTALRRSGYVMIKR
GQNREAMQSLLAAAEVLKSGRSVHIFPEGTRSATGELLPFKRGAFLVAIKGGAPVLPVTI
IGSHLITPKNSVKVNRGTIRLIIGKPIDPTQFNSAESLKNACAEVITEAFQRYRFN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcggtaccattttattttttcttgtactgattcctgtaatgtttgcaggaatg
tcgctatggctacttattagctttttcgacaaacaaggcgatatttttcaccgcattgct
gcatggtggggaggctttagcgcaaagctctttggcattaaaattgaggttattgggagt
gaaaattacaatccagcacaacattacttggtagtcagcaatcatgcgggcatggctgat
attccgttgctgttgggttgtatgaagctcaatttgcgatttcttgctaaggaggaactt
ggcagagtaccaatttttggtacagcgttgcgccgctcgggctacgtaatgattaagcga
gggcaaaaccgtgaagccatgcaaagcttgcttgctgcggctgaagtgttaaaaagcggg
cgatccgtccacattttccctgaaggtactcgctcagcaacgggcgaattactccctttt
aaacgaggcgcatttttagttgccataaaaggtggggctcccgttttaccggttaccatt
attggtagccacctgattactccaaaaaatagcgttaaagtaaatcgtggaactattcgc
ttgattattggcaaacctattgatcctacccaattcaatagtgctgaatcgctaaaaaat
gcttgcgcagaagtgattacagaggcgtttcagcgctataggtttaattga

DBGET integrated database retrieval system