KEGG   Chlorobium chlorochromatii: Cag_0138Help
Entry
Cag_0138          CDS       T00290                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cag_0138
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cag_0138
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cag_0138
Enzymes [BR:cch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cag_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(151639..152958)
Genome map
AA seq 439 aa AA seqDB search
MIYFSTNKSSVPVSLKKATLEGLAPDGGLYIPSEIPHFSEAEIKQLKGASFTNVAFAIAQ
KFAGSDIAAERLRAIIEECYNFPTPLVPLGSNTFIEELFCGPTLAFKDYGARFLARMTGY
FAEEEHKLITVLVATSGDTGSAVAYGFQGIKNTRVVLLYPSGKVSPLQEQQLTTAGDNVF
ALEVQGDFDDCQRMVKEAFVDPTLHEALTLTSANSINISRLIPQSFYYAWASLSIDEAFG
LQNPIFSVPSGNYGNVTAGILAKKMGFPIGHFIAASNANDSVTRYLVHGRYEPHPTIATL
STAMDVGNPSNFARLRYFYNNDFAAMADDISGIAVSDEETRATISKVHKQFGGYIMDPHT
AVGYRALEKYRESTNNANTPAIVLSTAHPAKFLEAIEATLQIPVPIPDHLQALMAKEKRS
TIIGAHYQELATFLKRLDR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatttactttagtaccaacaaatcctcagttcctgtctcattaaaaaaagccaccctt
gaagggcttgcgcctgatggtggactttatatcccttccgaaattcctcatttttctgag
gctgaaataaagcagctcaaaggcgcatcgtttaccaacgtagcgtttgcaattgctcag
aaatttgcgggcagcgatattgcagcagagcgtttacgcgcaattattgaagagtgctac
aacttccccaccccacttgtgccgcttggcagcaacacctttattgaagagcttttttgc
ggaccaaccttagcctttaaagattacggcgctcgctttcttgctcgtatgacgggctat
tttgccgaagaggagcataagctgattacggttttagttgccacttcgggcgatacggga
agtgcggttgcctatggttttcaaggcattaaaaatacgcgcgtggtgctactttatcca
tcgggcaaagtaagcccattgcaagagcagcaattaaccacagcaggcgacaacgtgttt
gcccttgaagtacaaggcgattttgacgattgccaacgcatggttaaagaggcgtttgtt
gaccccacattacatgaggcgttaacgcttacctctgctaactcgattaatatttcgcgc
cttatcccgcaatcattttactatgcgtgggcatcgctctctattgatgaggcgtttggc
ttgcaaaacccaatattttcggtgccaagcggcaattatggcaatgtaacagcgggcatt
ttggcaaaaaagatgggcttccctattgggcactttattgctgcatcaaacgctaacgat
agcgtaactcgttacttagtacatgggcgttatgagccacacccaaccattgccaccctt
tcaaccgcaatggatgtagggaaccccagcaactttgctcgcctccgctacttctacaac
aacgactttgcggcaatggcagatgatataagcggcattgctgtttcggatgaagagacg
cgtgcaaccatcagcaaagtgcataagcaatttggtggatatattatggatccacacacg
gcagtaggctaccgtgcgcttgaaaaatatcgtgaaagcaccaacaatgccaacacacca
gccattgtgctctctacggcacatccggcaaaattccttgaagccattgaagcaacgctc
caaattcccgtacctattcccgaccatttgcaagcattaatggcaaaagaaaaacgctcc
accattattggagcgcactatcaagagcttgctacttttttaaagcgattagatcgctaa

DBGET integrated database retrieval system