KEGG   Chlorobium chlorochromatii: Cag_0174Help
Entry
Cag_0174          CDS       T00290                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cch  Chlorobium chlorochromatii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cch01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cch00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
194938..195711
Genome map
AA seq 257 aa AA seqDB search
MTYLDRILEHKQIEVAALKKEQPRQRYEELQAELEAPRNFSASLKRPANKGVRLIAEIKK
ASPSRGLIVQDFDPLAMAQRYQELGAAAFSVLTDQQFFQGSNDYLRQVKGAFKLPVLRKD
FIVDALQIFEARLLGADAILLIVAALESSQLRDYLQLSAELGLSALVEVHDGAELDEALQ
QGATILGVNNRNLKDFSVDINTSIKLRPSIPSDMIAVAESGLKRAADIDAVNAAGFDAVL
IGEGLHISTELRSLIWT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcttgatcgtattcttgagcataaacagattgaggttgcggctttaaaaaaa
gagcaacctcgccagcgttacgaggagcttcaggcagaacttgaagctcctcgcaatttt
tcagccagcttaaagcgccctgccaataaaggggtacgcttaattgctgaaattaaaaaa
gcctcgccttcgcgcggtctcattgtgcaagattttgatccactcgcaatggcgcaacgc
tatcaagagctaggtgctgcggctttttcggtgcttaccgatcagcaattctttcaaggt
tcaaacgactatttacgtcaagtaaaaggtgcgtttaagctgcccgtgttgcgcaaagat
tttattgttgatgcactgcaaatttttgaagcacgcttacttggtgccgatgccattttg
ctgattgtcgccgcacttgaatcatcgcaattgcgcgattacttgcaactgtccgctgag
cttggtttatcggcattggttgaggtgcacgatggtgcggaacttgacgaagcgttgcag
caaggggcaaccattcttggggtgaataaccgtaacctgaaagatttttcggttgatatt
aatacatcaatcaagctgcgtccctctattccttctgatatgattgccgttgcagagagc
ggcttaaaaagagcggctgatattgatgctgtcaacgcggctggatttgatgcggtgctg
ataggcgaagggcttcatatcagcaccgaacttcgctcgcttatctggacatag

DBGET integrated database retrieval system