KEGG   Chlorobium chlorochromatii: Cag_0187Help
Entry
Cag_0187          CDS       T00290                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0187 (gpmA)
   01230 Biosynthesis of amino acids
    Cag_0187 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0187 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cag_0187 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cag_0187 (gpmA)
Enzymes [BR:cch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cag_0187 (gpmA)
Exosome [BR:cch04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cag_0187 (gpmA)
  Exosomal proteins of melanoma cells
   Cag_0187 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(214160..214903)
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWHDIDLTDQGRIEASNAGKLLRAEGFTFDIAYTSVLKR
AIRTLWHVLDEMDLMWLPVTKSWRLNERHYGALQGLNKAETAQKYGEEQVLVWRRSYDTP
PPALEKSDARYPGSQARYASLSEAEVPLTECLKDTVARFLPLWHETIAPEIRKGRNVIIA
AHGNSIRALVKYLDNVSEDDIVGINIPTGIPLVYELDDDLKPIRSYYLGDQDALKKAQEA
VAKQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacttgtattactgcgccacggcgaaagccaatggaaccgtgaaaatcgcttt
actggctggcacgatattgatttaactgaccaagggcgcatagaagcctcaaatgctggc
aagttgctccgtgccgaaggctttacttttgatattgcttacacctccgtgctcaagcgt
gccattagaaccttatggcatgtattggatgaaatggatttgatgtggctacctgttacc
aaaagctggcgtttaaatgagcgccattacggtgccttgcaaggcttaaacaaagcggaa
accgcacaaaaatatggcgaagaacaggtgcttgtgtggcgccgtagctacgacacccca
cctccagcacttgaaaaaagtgatgctcgttaccccggctctcaagctcgctatgcaagt
ttaagcgaagctgaagttccgcttactgaatgtttaaaagataccgttgctcgttttctg
cctctttggcacgaaaccattgcacccgaaattcgcaaagggcgcaacgttattattgcg
gctcacggcaactctattcgtgcattggtaaaatatcttgataatgtgtcggaagatgat
attgtaggaattaatattccaacgggtattccgttggtgtatgaattagatgatgatctc
aagccaattcgcagctactaccttggcgatcaagatgcactgaaaaaagcacaagaagcc
gttgcaaaacaaggaaaagcgtaa

DBGET integrated database retrieval system