KEGG   Chlorobium chlorochromatii: Cag_0199Help
Entry
Cag_0199          CDS       T00290                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0199
   00052 Galactose metabolism
    Cag_0199
   00500 Starch and sucrose metabolism
    Cag_0199
   00520 Amino sugar and nucleotide sugar metabolism
    Cag_0199
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cag_0199
   00524 Butirosin and neomycin biosynthesis
    Cag_0199
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cag_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227719..228699
Genome map
AA seq 326 aa AA seqDB search
MSRWALGIDFGGTAIKAAVISEGQGLVEDCRVPTNSSAGPEAIFSQLAELIGAMYHKGCA
TCDAANFAGVGLGAPGVVDVERGVLKYPPNLHGWGLVPLREELQQRLQQEHGLQVQIHLD
NDANVAAFGESRYGAGQPFPNFLMVTLGTGVGGGIVLNRSIYRGSYGTAGEVGFMIVDVD
SPHTHAGIHGTLEGMLGKKSIVAMACSMMHNAATTSTMGNYCNNDFSRLSPRHIEYAARE
GDAVALAVWERVGHLLGSALASVTALMDIRKFVIGGGISGAGSLIFEPARQQLLHSTHPS
MHEGLELVPAFLGNKAGMYGAASLCF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttgggcacttggtatagattttggtggaactgctattaaagcggctgttatt
agcgaagggcaagggttggttgaagattgccgtgtgccaacgaacagctcggcaggtccc
gaagctattttttcgcagcttgctgagttaataggcgcaatgtatcacaaagggtgtgct
acatgtgatgccgcaaattttgcaggtgttggcttaggggcacccggtgtggtagatgtg
gagcgtggtgttttaaaatatccacccaatttgcatggatggggcttggtgccattgcgt
gaggagttgcagcagcgtttgcagcaagagcatggtttgcaggtgcagattcacttggat
aatgatgcgaatgttgcggcgtttggcgaatcgcgttatggggcagggcaaccattccct
aactttttaatggttacgcttggcacgggcgttggtggtggcattgtacttaatcgctca
atttatcgaggcagttatggtacggcaggcgaggttggctttatgattgtggatgttgat
agcccccatacgcatgctggtattcacggaacgcttgaggggatgttgggcaaaaagtca
attgtagcaatggcttgtagcatgatgcacaacgcggcaaccacttccactatgggaaat
tattgcaataacgacttttcacgcctttcgcctcgccatattgagtatgctgcgcgcgaa
ggtgatgcggtggcgcttgccgtgtgggagcgtgttgggcatttacttggttcagcactt
gccagcgttacagctttaatggatattcgtaaatttgttattggaggtggaatttctggg
gctggttccttgatttttgaacctgctcggcagcaattactccactcaacgcacccttcc
atgcacgaagggctggagcttgtaccagcatttcttggcaataaagcaggaatgtatgga
gcggcatcgctctgtttttaa

DBGET integrated database retrieval system