KEGG   Chlorobium chlorochromatii: Cag_0230Help
Entry
Cag_0230          CDS       T00290                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cch  Chlorobium chlorochromatii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cag_0230
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cag_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(263926..264432)
Genome map
AA seq 168 aa AA seqDB search
MQQHTVYIGIGSNIGDRMSHLREALAMLNNLESTSVTAISAIYMTEPVGEINQERFYNGV
LAVTTSMQPEALRQECKAIERTIGRPATYQRWSPRVIDLDLLLFDTLVCQTDTLAIPHPE
LHHRNFVLIPLLDIANPTHPLLGKSIRELLALCPDRSVLIKLQENIAL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaacacaccgtttacattggcataggctccaatattggcgatagaatgagccac
ttgcgtgaagctcttgccatgctcaataatcttgaaagcacctctgtaaccgctatttcc
gctatttacatgacggagcctgttggcgaaatcaatcaagagcgcttttacaacggcgtg
cttgccgtaacaacctccatgcaacctgaagcattacgccaagaatgtaaagctattgag
cgcaccattgggcgtcctgcaacctatcagcgctggagccctcgtgttattgatttggac
ttgctgctttttgacacgcttgtgtgccaaaccgacacacttgccattccccaccccgaa
ctgcaccaccgcaactttgtgctcattccgttactagatattgccaatcctacccatcca
ttgcttggcaaaagtattcgtgaactgctcgccttgtgccccgatcgctcggtacttatt
aagttacaagagaacatagcgttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system