KEGG   Chlorobium chlorochromatii: Cag_0240Help
Entry
Cag_0240          CDS       T00290                                 

Definition
dihydroflavonol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cch  Chlorobium chlorochromatii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
271394..272383
Genome map
AA seq 329 aa AA seqDB search
MSKLSIALTGATGYIGSQVLLELLKRFKGELDCRVLVRGSSNYAWLEALPVQVIAADVLE
PIALHEALRGVDTLFHCAGLVSWTRRFRSQLYEVNVVGTRNVLHAALYNGVRRVVMTSSI
AAVGMSEDGAPANEAALFKEWQRRNGYMEAKHLAELEALRAVAEGLDVVLLNPGVVIGVD
HHNPASLSSSNRTLRQMYDEKLWVAPAGSTGFVDVRDVAMAHIAAWEKGKSGERYIVVGH
NVSFHELLSRLSALNNGVAAKVLTVPRSVGMVAALGGEAWSLLTGNPSFIAFESIGTSAR
QLAYNNERSLCELGIAYHDLEETFQTILK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactctccattgctcttaccggtgctaccggctacataggttcgcaagtgctg
cttgagttgctcaagcgttttaagggtgaacttgattgccgcgtgttggtgcgtggcagc
tccaattatgcgtggttggaggcgttgccggtgcaagtaattgctgccgatgtgcttgag
ccaattgctttgcatgaggcgttgcgtggtgtggatacgctttttcattgtgcgggtttg
gtgtcgtggacgcgccgttttcgctctcagctttatgaggtaaatgtggtgggcacgcgc
aatgtgcttcatgcggcgctttataatggtgtgcgccgtgtggtaatgaccagctccatt
gcagcggttggcatgtcggaagatggtgcgcctgctaacgaggcggcgttgtttaaagag
tggcagcgacgcaatgggtacatggaggcaaaacatcttgccgagcttgaggcgttgcgt
gcggtggctgaagggttggatgtagtgctgttgaatccgggcgtggtgattggtgttgac
caccacaatccagcatcccttagctcgtcaaaccgtacacttaggcaaatgtatgatgaa
aagctatgggttgcacctgcgggtagcacgggttttgtagatgtgcgcgatgttgccatg
gcgcatattgcggcgtgggaaaaagggaaatcgggggagcgttacattgtggtagggcat
aacgtgagcttccatgaattactcagccgtttatcagctcttaacaatggtgttgccgct
aaggtgcttacggtgccccgttcggtgggaatggttgcagcccttggtggcgaagcgtgg
tcgctcttgacgggaaatccttcgtttattgcttttgaaagtattggcacctcagcgcgg
cagttggcatacaataatgagcgttcactttgcgagttgggcattgcgtatcacgattta
gaagagacatttcaaacaattcttaaataa

DBGET integrated database retrieval system