KEGG   Chlorobium chlorochromatii: Cag_0338Help
Entry
Cag_0338          CDS       T00290                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cch  Chlorobium chlorochromatii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0338
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cag_0338
   00640 Propanoate metabolism
    Cag_0338
   00660 C5-Branched dibasic acid metabolism
    Cag_0338
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cag_0338
Enzymes [BR:cch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cag_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(379999..381171)
Genome map
AA seq 390 aa AA seqDB search
MNIHEYQGKDILRKFGVTVPKGIVAYSADEAKQAAEQLFAETGSSVVVVKAQIHAGGRGK
AGGVKLAKSPEEAFEIARQMIGMTLITHQTGPEGKVVSRLLIEEGMGIEKEFYVGITLDR
ATSRNVLMVSTEGGMEIETVAEETPEKLLKIQIDPLFGMQGFQAREAAFFLGLEGEQFRN
AVNFITALYKAYTSIDASVAEINPLVVTSEGKVIALDAKINFDDNALYRHKEYMELRDTS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDIIQLAGGKPANFLDVGGTASPQ
TVEEGFKIILSDKNVRAILVNIFGGIVRCDRVAGGIMEAAKKMDLHLPVIVRLEGTNASI
AQQMLDESGLSLIAAKGLRDAAQKVQEALA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaaggcaaggatatcctcagaaaatttggggttaccgtgcca
aaaggcattgtggcttattcggctgatgaagcaaagcaagcagcagagcaactttttgct
gaaacgggttcttccgttgtggttgtaaaagcacaaatccacgcaggtggacggggtaaa
gcgggtggtgttaaacttgcaaaatcacctgaagaggcatttgaaattgctcgccaaatg
attggcatgacgcttattacgcatcaaaccggtcctgaaggtaaagtggtaagtcggctg
cttattgaagagggcatgggaattgaaaaagaattttacgttggcatcacgcttgatcgt
gctacctcacgcaatgtgttgatggtatcaacggaaggtggtatggaaattgaaaccgtt
gccgaagaaacacctgaaaagctcctaaaaattcaaattgacccgcttttcggcatgcaa
ggctttcaagctcgcgaagccgcatttttccttgggcttgagggtgaacagttccgcaat
gccgtaaattttattacagctctttataaagcttacacctcaattgatgcctcagtggct
gaaattaatcctttagtggttacttctgaaggcaaggtgattgctttggacgcaaagatt
aattttgatgataacgccctctatcgccataaagagtacatggaattgcgcgacaccagc
gaggaagatccatttgaagttgaagcttcaaagtctaacttgaactatgtgcgccttgat
ggtaatgtgggctgcatggtgaatggcgctggcttagcaatgggcacgatggatattatt
cagcttgctggtggtaaacctgcaaactttcttgatgttggtggcacagcaagtcctcaa
accgtagaagaaggctttaagattattttaagcgataaaaatgttcgtgctattttagtg
aacatttttggaggcattgtacgctgcgaccgtgtagctggaggtattatggaagctgcc
aagaaaatggatttacacttgcccgttattgtgcgccttgagggcacaaatgcgtccatt
gcacagcaaatgcttgatgaatcgggcttaagcttaattgcggctaaggggttgcgtgat
gcagctcaaaaggtgcaagaagcattagcttaa

DBGET integrated database retrieval system