KEGG   Chlorobium chlorochromatii: Cag_0339Help
Entry
Cag_0339          CDS       T00290                                 

Definition
(GenBank) Endoglucanase Y-like protein (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
cch  Chlorobium chlorochromatii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(381437..382633)
Genome map
AA seq 398 aa AA seqDB search
MRRFWTFLLISCAPFFLSSCSSVPQNPEKISTEAWHYYRDTFIKNGRVIRPQNNNDTVSE
GQAYTMVRAVLMKDRKTFDECLAWSEKVLSRKNSDGDYLLAWHYRDGKVTDTTAASDADI
DYAFSLIVASKIWQAPRYLELAKEVLASILEAETTRHQGRLYLLPWPANKNKPGDLLAQN
LSYYAPSHFKLFYETTSDPRWLELVDTTYYLLGRLLHPGELPEGPIVPDWIAINDAGAFV
HLPGKDVRYGWDAVRVPMRIAADYHLYGDKRAFEVLSWLAVSFEEEFRQQSKFLLQRDST
LQVRNNALFYSAMYASLEATESPSAPKLLQRIRKFIRQEKQGLFYNHPDDYYINSLCWIT
EYYEQNKKHLQARSKKVALPLQTHESTANTASLSLQAP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtttttggacttttttgttgattagttgtgctcctttctttttatcgagttgc
tcatctgttccacaaaatccagaaaagatttctacggaagcatggcactactatcgcgat
acgtttataaaaaatggtcgcgttattcgtcctcaaaacaataatgatactgtttcggag
gggcaagcttacacaatggttcgtgcggttttaatgaaggatcgcaaaacctttgatgaa
tgccttgcttggagcgaaaaggtgctctcccgtaaaaatagtgatggtgattatttgctt
gcatggcattaccgtgatggcaaagttaccgatacaacggcagcctctgatgccgatatt
gattatgcttttagcttaattgttgcctcaaaaatatggcaggcacctcgttaccttgag
cttgctaaagaggtgcttgcaagcattctggaagcggaaaccacgcgccatcaagggcgt
ttatatttattgccgtggcctgcaaacaaaaacaagccaggtgatttattagcacaaaac
ctctcttactacgcaccttcccatttcaagcttttttacgaaaccacaagcgaccctcgt
tggcttgagcttgtggatacaacctactacttattgggacgcttgctgcaccctggtgaa
ttaccagagggacctattgtgcctgattggattgctataaatgatgctggcgcttttgtg
catttaccgggtaaagatgtacgctatggctgggatgctgtaagagtgccaatgagaatt
gcggctgattaccatttatatggcgataaacgtgcttttgaggtgctcagttggttagcg
gtatcgtttgaggaggaatttcgccaacaatcaaaatttttgttacagcgagattcaacc
ctccaagtgcgtaataatgcccttttttatagcgctatgtatgcttcgttagaagcaacg
gaatcgccaagtgcccctaagttgctacaacgcattcgcaagtttattaggcaagagaag
caaggtttgttttataatcatcctgatgattactacatcaacagcctatgctggattacg
gagtattacgagcaaaacaaaaaacacttacaagcacgttctaaaaaagttgctcttcca
ttacaaacccacgaaagtacagcaaacacggcatccttgagtttacaagcaccatag

DBGET integrated database retrieval system