KEGG   Chlorobium chlorochromatii: Cag_0339Help
Entry
Cag_0339          CDS       T00290                                 

Definition
endoglucanase Y-like protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cch  Chlorobium chlorochromatii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cag_0339
Enzymes [BR:cch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cag_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(381437..382633)
Genome map
AA seq 398 aa AA seqDB search
MRRFWTFLLISCAPFFLSSCSSVPQNPEKISTEAWHYYRDTFIKNGRVIRPQNNNDTVSE
GQAYTMVRAVLMKDRKTFDECLAWSEKVLSRKNSDGDYLLAWHYRDGKVTDTTAASDADI
DYAFSLIVASKIWQAPRYLELAKEVLASILEAETTRHQGRLYLLPWPANKNKPGDLLAQN
LSYYAPSHFKLFYETTSDPRWLELVDTTYYLLGRLLHPGELPEGPIVPDWIAINDAGAFV
HLPGKDVRYGWDAVRVPMRIAADYHLYGDKRAFEVLSWLAVSFEEEFRQQSKFLLQRDST
LQVRNNALFYSAMYASLEATESPSAPKLLQRIRKFIRQEKQGLFYNHPDDYYINSLCWIT
EYYEQNKKHLQARSKKVALPLQTHESTANTASLSLQAP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtttttggacttttttgttgattagttgtgctcctttctttttatcgagttgc
tcatctgttccacaaaatccagaaaagatttctacggaagcatggcactactatcgcgat
acgtttataaaaaatggtcgcgttattcgtcctcaaaacaataatgatactgtttcggag
gggcaagcttacacaatggttcgtgcggttttaatgaaggatcgcaaaacctttgatgaa
tgccttgcttggagcgaaaaggtgctctcccgtaaaaatagtgatggtgattatttgctt
gcatggcattaccgtgatggcaaagttaccgatacaacggcagcctctgatgccgatatt
gattatgcttttagcttaattgttgcctcaaaaatatggcaggcacctcgttaccttgag
cttgctaaagaggtgcttgcaagcattctggaagcggaaaccacgcgccatcaagggcgt
ttatatttattgccgtggcctgcaaacaaaaacaagccaggtgatttattagcacaaaac
ctctcttactacgcaccttcccatttcaagcttttttacgaaaccacaagcgaccctcgt
tggcttgagcttgtggatacaacctactacttattgggacgcttgctgcaccctggtgaa
ttaccagagggacctattgtgcctgattggattgctataaatgatgctggcgcttttgtg
catttaccgggtaaagatgtacgctatggctgggatgctgtaagagtgccaatgagaatt
gcggctgattaccatttatatggcgataaacgtgcttttgaggtgctcagttggttagcg
gtatcgtttgaggaggaatttcgccaacaatcaaaatttttgttacagcgagattcaacc
ctccaagtgcgtaataatgcccttttttatagcgctatgtatgcttcgttagaagcaacg
gaatcgccaagtgcccctaagttgctacaacgcattcgcaagtttattaggcaagagaag
caaggtttgttttataatcatcctgatgattactacatcaacagcctatgctggattacg
gagtattacgagcaaaacaaaaaacacttacaagcacgttctaaaaaagttgctcttcca
ttacaaacccacgaaagtacagcaaacacggcatccttgagtttacaagcaccatag

  All links  
No link information was found.   
DBGET integrated database retrieval system