KEGG   Chlorobium chlorochromatii: Cag_0372Help
Entry
Cag_0372          CDS       T00290                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00790  Folate biosynthesis
cch01100  Metabolic pathways
Module
cch_M00843  L-threo-Tetrahydrobiopterin biosynthesis, GTP => L-threo-BH4
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cag_0372
Enzymes [BR:cch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cag_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ABB27645
JGI: Cag0372
UniProt: Q3ATN0
Position
complement(428716..429387)
Genome map
AA seq 223 aa AA seqDB search
MKQEKTPSAITENKLPFSSSNCGCGCHNDDDTLTHDDGLLTDNLESAVYTMLQNVGEDPQ
REGLLKTPERVARSMRFLTKGYHENPEELLQKALFTESYDEMVLVRDIDLFSMCEHHMLP
FFGKAHVAYIPDGKIVGLSKLARVVEVFSRRLQVQERLTQQIRDAIQNVLNPKGVAVVIE
AKHLCMVMRGVEKLNSITTTSAMSGVFMTSPSTRGEFLRLIQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggaaaaaacgccgtccgctattacggagaataagctaccgttttcctcatcc
aattgcggatgcggctgccacaatgatgatgatacactaacgcatgatgacggattgctg
actgacaacttagaatctgccgtttacaccatgctgcaaaacgtgggtgaagatccccag
cgtgaagggttgctaaaaacccctgagcgcgttgcacgctccatgcgctttcttaccaaa
gggtatcacgaaaaccccgaagagctgttacaaaaagccctctttaccgaaagctatgac
gaaatggtattagtgcgcgatattgatcttttttcgatgtgcgagcaccacatgcttccc
ttttttggcaaagcccacgtagcatacattcccgatggcaaaattgtaggactttcaaag
cttgcccgtgtggttgaagttttttcgcgccgactacaagtgcaagagcgcctaacgcag
caaattcgtgatgcaattcaaaacgtgctgaatcccaaaggcgttgctgtggttattgag
gcaaagcacctttgcatggtaatgcgtggcgttgaaaagctcaattccattaccacaacc
tccgcgatgtcgggcgtttttatgacctcaccgtcaacacgcggcgagtttttgcgctta
atccaaaaataa

DBGET integrated database retrieval system