KEGG   Chlorobium chlorochromatii: Cag_0497Help
Entry
Cag_0497          CDS       T00290                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0497 (tpiA)
   01230 Biosynthesis of amino acids
    Cag_0497 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0497 (tpiA)
   00051 Fructose and mannose metabolism
    Cag_0497 (tpiA)
   00562 Inositol phosphate metabolism
    Cag_0497 (tpiA)
Enzymes [BR:cch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cag_0497 (tpiA)
Exosome [BR:cch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cag_0497 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cag_0497 (tpiA)
  Exosomal proteins of melanoma cells
   Cag_0497 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
580210..580968
Genome map
AA seq 252 aa AA seqDB search
MRKKIVVGNWKMNNGVAASEQLAADLLAALGSSFTGCDVGIAPTFLSLTTAGKVIAGSTI
QLVAQNCHYENDGAYTGEVSAAMLKGAGCSSVIIGHSERRQFFGETNATVNLRVKKALAE
GLDVILCVGETLAERESGVTGDIVSAQVREGLVGVSDISNVVIAYEPVWAIGTGKTATSA
QAEEVHLMIRTLVTELYGEPAAQALRIQYGGSVKPSNAVELFAMPNIDGGLIGGASLNAA
DFVAIVQAAAGK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattgttgttggcaattggaaaatgaataacggtgttgccgcttccgag
caacttgccgccgatcttcttgccgcgttaggcagcagctttactggctgtgatgttggt
attgcgcctacctttctttcccttacaacggctggtaaagtaattgctggctcaactatt
cagcttgtagcgcaaaattgccattatgaaaatgatggtgcttatacgggcgaagtttcc
gcagcaatgctgaaaggagcaggatgtagctcagttattattgggcattcagaacgccgc
caattttttggcgaaaccaatgccaccgttaacctgcgtgtaaaaaaagcgttagccgaa
gggcttgatgttattttgtgtgttggcgaaaccttagccgagcgcgaaagcggtgttacc
ggcgatattgtgtcagcgcaagtacgtgaaggattagttggtgtaagcgatatcagtaac
gtggtaattgcttatgagccagtgtgggcaattggtaccggtaaaacagcaacttccgca
caagccgaagaggtgcacttgatgattcgcaccttagtaacggagctttatggcgagcca
gccgcacaagctttgcgcattcagtatggcggtagtgtaaagccctccaatgcggttgag
cttttcgctatgccaaatattgatggtggcttaattggtggagccagcttaaatgctgcc
gattttgtggctattgtgcaggcagcagcagggaagtaa

DBGET integrated database retrieval system