KEGG   Chlorobium chlorochromatii: Cag_0702Help
Entry
Cag_0702          CDS       T00290                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cch  Chlorobium chlorochromatii
Brite
Enzymes [BR:cch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Cag_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
974478..974906
Genome map
AA seq 142 aa AA seqDB search
MQTSDNGLNIIRQYEGLRLKTYFCPAGKLTIGYGHTGTDVTSGMSITEAQANELLQEDVK
RFATSVNKMVTTEVTQGMFDALISFSYNIGAGNLQKSTLLKKLNAGDKQGAADEFLKWNK
SNGKPLAGLTARRTAERELFLA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaagcgacaacggtttaaatattatccgtcaatatgagggactgcgcttaaaa
acatacttttgccctgctggaaaattaacgattggctatgggcatacgggcacggatgtt
acatcgggcatgagcattaccgaggcgcaagcaaatgaattgttgcaagaagatgtaaag
cgctttgcaacttcggttaataaaatggtaacaacggaggttacgcaaggaatgtttgat
gcgctcattagtttttcatacaacattggagctggtaacttgcaaaaatcaactcttttg
aaaaaactgaatgcgggcgataaacaaggtgccgctgatgagtttctgaaatggaataaa
tctaatggtaagccacttgctggtcttactgctcgtcgtacagccgagcgagagttgttt
ttagcgtaa

DBGET integrated database retrieval system