KEGG   Chlorobium chlorochromatii: Cag_0770Help
Entry
Cag_0770          CDS       T00290                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cch  Chlorobium chlorochromatii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cag_0770
Enzymes [BR:cch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cag_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1087346..1089085
Genome map
AA seq 579 aa AA seqDB search
MITYNERPIDRHFAKMLLQHCGNSKHELLPLLFSMVSNAIGQGSVCLNLADIAAQSVTYG
NRTVQLPPLAELMRLFSTLPVVSRNGAEFRPLVIDNVGRLYLYRYWRYEHDLAEALRQKA
STKSCTIEKKSEAVQVLLQQLFPEGSDAQQKQAAEVALHRRFCIISGGPGTGKTTTVVRI
VALLLEQAGGERLRIALAAPTGKAAARLKQSISTIRGTLSCSQTLQQAIPSEVVTIQRLL
GAIPNSTRFRYHQRNPLPYDVLIVDEASMVSLSLMHALLMALKPECRLILLGDRHQLASV
EEGAMLGDLCSAVGEATPHSPLAGTLVMLEKSYRFQTGGAIAELSRAMNQGEGEQALALL
QSNQSAALRWQPLPTPDALPSALGRAAVAGYRAYCEATTPAEAMERFERFRILAALREGI
YGVSGLNRFVEQALAREGLLAPTSLWYAYRPVLITVNDYNVRLFNGDTGLLLPDAENGGV
SAWFTTPDGGLRRLPPERLPAHETAFCMTIHKSQGSEFDNVLLILPPTDTPLLSRELLYT
GVTRAKSRVEVWGDPTFVQAACKRTTIRHSGFREALALE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgataacctataacgagcgcccaatagatcgccattttgctaaaatgttgcttcagcac
tgtggcaattcaaagcatgagctgttgccgttgcttttttcaatggtaagtaacgccatt
gggcaggggagtgtttgcttaaatcttgccgatattgccgctcaatccgttacgtatggt
aaccgtaccgtgcagcttccaccacttgcggagctgatgaggctcttctccaccttgcca
gtagttagccgtaacggtgcggaatttcgtcccttagtgattgataacgttggtcgcctc
tacctttaccgttattggcgctacgagcacgatcttgctgaagcgttgcgccaaaaagca
tccaccaaatcatgtacgatagaaaaaaagagcgaagcggtgcaagtgctgttacaacag
ctttttcctgaaggttctgacgcacagcaaaagcaagcggctgaagtggcattgcatcgc
cgtttttgcattatatcaggcggaccaggtacgggcaaaacgacaacggtggtgcgcatt
gtggcgctcttgttggagcaagcgggtggagagcggttgcgcattgcccttgccgctcca
acgggcaaagccgctgcacgcctcaagcaatccatcagcaccattcgtggcactctttca
tgctctcaaacattacaacaagccattccgagcgaagtggttactattcagcgcttgctt
ggagccattcctaattccacccgctttcgctaccatcaacgcaatccactcccttacgat
gtgctgattgtggatgaagcctccatggtgtcgctctcattgatgcacgcgctgctgatg
gcgctcaaacccgaatgccgcttaattctccttggcgatcgccaccaacttgcctctgtg
gaagagggtgccatgttgggcgatctctgtagtgcggtaggggaggcaacgccccactcg
ccgcttgcaggcacgttggtgatgttggaaaaaagctatcgctttcaaacgggtggcgca
attgctgagctaagccgcgcaatgaatcagggagaaggcgaacaagcgcttgccctgctc
caaagcaaccaatcagccgcattgcgttggcagccgttgcccacgcccgatgctctgcca
agcgcacttggacgtgcagcggtggcgggctatcgtgcttattgcgaagccacaacacct
gcggaggcaatggagcgctttgagcgttttcgcattcttgcggctttgcgagagggcatt
tatggcgtaagcggcttaaatcgctttgtcgaacaagcccttgcccgcgaaggattgctt
gcgccaacatcactatggtacgcctatcgccccgtgctcattaccgtcaacgactacaac
gtgcggctttttaatggcgatacgggattgctcttgcccgatgccgaaaatggtggcgta
agcgcatggtttaccacgcccgatggaggcttacgtcgcttgccacccgaacgcctgcct
gcgcacgaaacagctttttgcatgaccatccataaaagccaaggttccgaatttgataat
gtcttattgattttaccgccaaccgatacccctctgctttctcgcgagctgctctacaca
ggggttacacgagcaaaaagtagggttgaagtgtggggcgacccaacatttgtgcaagct
gcctgcaagcgcaccaccattcgccattcaggctttcgtgaagccttagcgctggaataa

DBGET integrated database retrieval system