KEGG   Chlorobium chlorochromatii: Cag_0787Help
Entry
Cag_0787          CDS       T00290                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cch00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cch02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1104851..1106185)
Genome map
AA seq 444 aa AA seqDB search
MFSKKIIRDAGIGLFLLGLSNGAHAVTHLASVPKPKIGNVIFMHPDGTSVSHWTAARMAI
AGPDGTINWDRLPAMAVYRGHMKNSTGATSHGGATTHAFGVKVDADSYGMDRDRALTALS
GKPMSIMREALAAGLAVGVVNSGNIDEPGTGVFLASSRSRKDGQAIAEQIIYSGAQVIMS
GGERWLLPKGVKGRHGEGERSDGKNLIDVAQTLGYTIVYNRDELANLPKDTKRVLGVFAH
HHTFFDHPEEELQKQKLPLYVANAPTVGEMTDAALRILSNQGKRFLLVVEEEGTDNFGNV
NNAVGTLEALRRADAAYGVARSYVQRNPATLLLTAADSDASGLEVVSVAPDVAMKPLNKT
THNGAPLDGRTGTQSLPFIAEADQFGNRLPFGIAWTDMNDGAGGILARAEGINSEALRSG
SCDNSDVYRLMYLTLFGRSADSKK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttctctaagaaaataattcgtgacgctggtattggcttatttttattggggttaagt
aatggtgctcatgccgttacccatttagcttctgtaccaaaaccaaaaattggaaatgta
atttttatgcatcctgatggtaccagtgtttcgcattggacggctgctcgtatggctatt
gctggacctgatggcaccatcaattgggatcgcttacctgcaatggctgtgtatcgtgga
cacatgaaaaattcgactggcgcaacatcacatggtggagcaacaacccatgcttttggg
gtaaaagtagatgctgattcgtatggcatggatcgtgatcgcgcgcttactgctctttcg
ggtaaaccaatgagcattatgcgcgaggctctcgctgctggattagcggttggagtggtt
aattcaggtaatattgatgagcccggtacaggcgtatttttagcttcatcgcgtagccgt
aaggatgggcaagcaattgctgagcaaataatttacagtggtgcgcaggttattatgtcg
ggaggtgagcgttggcttttgccgaaaggggttaaagggcgtcatggagagggtgagcgc
agtgatggcaaaaatcttattgatgtagcacagactcttggttatactattgtgtataac
agagatgaattagcaaatcttcctaaagatacgaagcgggtacttggtgtatttgcacat
catcatactttttttgatcaccctgaagaggaattacaaaagcaaaaattaccactctat
gttgccaatgctccaacagttggtgaaatgaccgatgctgcgttgcgtattttatcgaat
caggggaaacggtttttattagtggttgaagaagagggaacggataattttgggaatgtg
aataatgccgtaggtacccttgaggcgcttcgtcgtgctgatgctgcttacggggttgcg
cgttcttatgtacaacgcaatcctgcaacattgttgcttacggctgctgatagtgatgca
agtggtttagaggttgtgtcggttgctcctgatgtagcaatgaagccactgaataaaacc
acgcataatggtgcacctttagatggacgtacaggtacacaatcgttgccatttattgcc
gaagccgatcaatttggtaatcgcctaccttttggtattgcttggactgatatgaacgat
ggggctggtggtattcttgcgcgagctgagggcataaattctgaagctttacgaagtggt
agttgcgataatagcgatgtgtatcgccttatgtacctaacactttttggacgttcagcc
gatagcaagaagtaa

DBGET integrated database retrieval system