KEGG   Chlorobium chlorochromatii: Cag_0793Help
Entry
Cag_0793          CDS       T00290                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase family protein
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cch  Chlorobium chlorochromatii
Brite
Enzymes [BR:cch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Cag_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_10 NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NmrA RmlD_sub_bind KR adh_short Sacchrp_dh_NADP TrkA_N Semialdhyde_dh CBP_BcsR
Motif
Other DBs
NCBI-ProteinID: ABB28059
JGI: Cag0793
UniProt: Q3ASG6
Position
1113714..1114709
Genome map
AA seq 331 aa AA seqDB search
MSKNILVTGATGFIGSNLVRKLVTTTEHRISILVRKNSDISALADVRDRIQLVYGDITQR
SSLDAAMQGVHHVYHSAGLTYMGDKKNSLLYKINVDGTHNMLDAAIAAHVDRFIHVSSIT
AVGIAFDKKPVNEATPWNFHALGLEYARTKHLSEKEVAKAIQRGLDCVIVNPAFVFGAGD
INFNAGRIIKDIYNRRLPFYPLGGICVVDVEIVSDAIITAMAKGKTGERYIIGGDNVSYK
QLSDTISRVTGAPKVLLPLPFWTARILYSLLDLYHNRRRLSKLFNLSMFKVASHFLYFDS
SKAARELNMRYEPHEQSIRNAYEWYRERNML
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaacatccttgtaaccggtgccaccggttttatcggctccaacttggtgcgc
aaacttgttactacaacagagcaccgtatttccattcttgtccgcaaaaattccgacatt
agcgcccttgccgatgtgcgcgataggattcagcttgtgtatggcgatattactcagcgc
tcatcgcttgatgctgccatgcaaggggttcaccatgtgtaccactccgctggcttaacc
tacatgggcgacaaaaaaaattcccttctttataaaattaatgtagatggcactcacaat
atgttggatgccgctattgcagcgcacgttgatcgctttattcatgtaagttctattaca
gccgttggtatagcgtttgataaaaagcccgttaatgaagcaactccatggaattttcat
gcgcttggtttggaatatgcacgcacaaaacatctttcagaaaaagaggtagcgaaagca
atacagcgagggcttgattgtgttattgtaaatcctgcatttgtgtttggagcgggcgat
ataaactttaatgctggacgtattattaaagatatttataatcgtcgcttacctttttat
ccgcttggtggtatttgtgtggttgatgtagagattgtatctgacgctattattacagca
atggcaaaagggaaaacaggggagcgttatattattgggggtgataatgtttcctataaa
cagctttctgatactatttcacgggtaacgggtgctcctaaggtgcttttacctttaccg
ttttggacggcgcgtattctttattcgcttttagatctttaccataatcgtcgtcgtctc
tcaaagctgtttaatctctccatgtttaaggtggcatcccactttttgtactttgattcc
tctaaagctgcccgtgaactcaatatgcgttatgaaccgcatgagcaaagcattcgcaat
gcctatgagtggtatcgcgaacgcaacatgctataa

DBGET integrated database retrieval system