KEGG   Chlorobium chlorochromatii: Cag_0793Help
Entry
Cag_0793          CDS       T00290                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cch  Chlorobium chlorochromatii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1113714..1114709
Genome map
AA seq 331 aa AA seqDB search
MSKNILVTGATGFIGSNLVRKLVTTTEHRISILVRKNSDISALADVRDRIQLVYGDITQR
SSLDAAMQGVHHVYHSAGLTYMGDKKNSLLYKINVDGTHNMLDAAIAAHVDRFIHVSSIT
AVGIAFDKKPVNEATPWNFHALGLEYARTKHLSEKEVAKAIQRGLDCVIVNPAFVFGAGD
INFNAGRIIKDIYNRRLPFYPLGGICVVDVEIVSDAIITAMAKGKTGERYIIGGDNVSYK
QLSDTISRVTGAPKVLLPLPFWTARILYSLLDLYHNRRRLSKLFNLSMFKVASHFLYFDS
SKAARELNMRYEPHEQSIRNAYEWYRERNML
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaacatccttgtaaccggtgccaccggttttatcggctccaacttggtgcgc
aaacttgttactacaacagagcaccgtatttccattcttgtccgcaaaaattccgacatt
agcgcccttgccgatgtgcgcgataggattcagcttgtgtatggcgatattactcagcgc
tcatcgcttgatgctgccatgcaaggggttcaccatgtgtaccactccgctggcttaacc
tacatgggcgacaaaaaaaattcccttctttataaaattaatgtagatggcactcacaat
atgttggatgccgctattgcagcgcacgttgatcgctttattcatgtaagttctattaca
gccgttggtatagcgtttgataaaaagcccgttaatgaagcaactccatggaattttcat
gcgcttggtttggaatatgcacgcacaaaacatctttcagaaaaagaggtagcgaaagca
atacagcgagggcttgattgtgttattgtaaatcctgcatttgtgtttggagcgggcgat
ataaactttaatgctggacgtattattaaagatatttataatcgtcgcttacctttttat
ccgcttggtggtatttgtgtggttgatgtagagattgtatctgacgctattattacagca
atggcaaaagggaaaacaggggagcgttatattattgggggtgataatgtttcctataaa
cagctttctgatactatttcacgggtaacgggtgctcctaaggtgcttttacctttaccg
ttttggacggcgcgtattctttattcgcttttagatctttaccataatcgtcgtcgtctc
tcaaagctgtttaatctctccatgtttaaggtggcatcccactttttgtactttgattcc
tctaaagctgcccgtgaactcaatatgcgttatgaaccgcatgagcaaagcattcgcaat
gcctatgagtggtatcgcgaacgcaacatgctataa

DBGET integrated database retrieval system