KEGG   Chlorobium chlorochromatii: Cag_0796Help
Entry
Cag_0796          CDS       T00290                                 

Definition
citrate lyase, subunit 1 (EC:6.2.1.5)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cch  Chlorobium chlorochromatii
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0796
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cag_0796
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cag_0796
Enzymes [BR:cch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cag_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1116440..1117636
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVVMDPNRLAHLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEQAVEASREMIGRKIGTAMISQVIVAEMLDHDEEYYISIAGNRDGSELLV
SNRGGVDIEDNWDTVRRLAITIGETPTIERITEVATEAGFEGEIAERVAKIASRLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNLDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDARIKGSVKFVEVPGGNIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPADWAV
EALTETICRLPNIKHIIVGGAIANFTDVRATFSGIINGFRSSKARGYLENVKIWVRRGGP
NEAQGLAAMKQLQEEGFDIHVYDRSMPMTDIVDLALNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggccagccatgaagctatttaacaaatggggcattcctgtg
cctaattatgttgtagtcatggatcccaaccgccttgcgcaccttggtgaagctaataaa
tggcttagagaatcaaaacttgtggttaaagcacacgaggctattggtggacgttttaag
cttggcttggttaagcttggactaaaccttgagcaagctgttgaagcatcgcgtgaaatg
attggtcgcaaaattggtacggctatgattagtcaagtgattgtagcagaaatgcttgat
cacgatgaagagtactacatttctattgcaggtaaccgtgatggaagtgagttattggtt
tcgaacagaggtggtgttgacattgaagataattgggatacggttcgtcgtcttgctatt
actattggagaaactccaaccattgagcgcattaccgaagtagccacagaagcaggtttt
gagggtgaaattgctgagcgtgtagcaaaaattgcttctcgcttaattctttgttttgat
aatgaagatgctcaatctattgaaattaatccgcttgttattcgtaagagcgatatgcgc
tttgcggctcttgatgcagtaatgaatcttgattgggatgcacgtttccgtcatgcagat
tgggactttaaacccgtttctgaaattggacgtccctttactgaagccgagcaacaaatt
atggaaattgatgcccgcattaaaggttctgtaaaatttgttgaagtaccaggtggtaac
attgctcttttaaccgcaggtggtggcgcttcagtattttactccgatgctgtagttgct
cgtggtggcactattgcaaactatgcagaatattcgggtgatcctgcagattgggcggtt
gaggcacttaccgaaaccatttgccgcttaccaaacattaagcacattattgttggtgga
gctattgcaaacttcactgatgttagagcaacctttagtggtattatcaatggtttccgt
tcaagcaaagcaagaggctaccttgaaaatgtgaaaatttgggtacgtcgtggcggtcca
aacgaagcacaagggcttgctgctatgaaacagcttcaagaagagggcttcgacattcat
gtttatgatcgtagtatgccaatgaccgacattgttgatcttgcattgaattcataa

DBGET integrated database retrieval system