KEGG   Chlorobium chlorochromatii: Cag_0796Help
Entry
Cag_0796          CDS       T00290                                 

Definition
citrate lyase, subunit 1 (EC:6.2.1.5)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cch  Chlorobium chlorochromatii
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cch01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cch00020]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:cch00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1116440..1117636
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVVMDPNRLAHLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEQAVEASREMIGRKIGTAMISQVIVAEMLDHDEEYYISIAGNRDGSELLV
SNRGGVDIEDNWDTVRRLAITIGETPTIERITEVATEAGFEGEIAERVAKIASRLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNLDWDARFRHADWDFKPVSEIGRPFTEAEQQI
MEIDARIKGSVKFVEVPGGNIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPADWAV
EALTETICRLPNIKHIIVGGAIANFTDVRATFSGIINGFRSSKARGYLENVKIWVRRGGP
NEAQGLAAMKQLQEEGFDIHVYDRSMPMTDIVDLALNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggccagccatgaagctatttaacaaatggggcattcctgtg
cctaattatgttgtagtcatggatcccaaccgccttgcgcaccttggtgaagctaataaa
tggcttagagaatcaaaacttgtggttaaagcacacgaggctattggtggacgttttaag
cttggcttggttaagcttggactaaaccttgagcaagctgttgaagcatcgcgtgaaatg
attggtcgcaaaattggtacggctatgattagtcaagtgattgtagcagaaatgcttgat
cacgatgaagagtactacatttctattgcaggtaaccgtgatggaagtgagttattggtt
tcgaacagaggtggtgttgacattgaagataattgggatacggttcgtcgtcttgctatt
actattggagaaactccaaccattgagcgcattaccgaagtagccacagaagcaggtttt
gagggtgaaattgctgagcgtgtagcaaaaattgcttctcgcttaattctttgttttgat
aatgaagatgctcaatctattgaaattaatccgcttgttattcgtaagagcgatatgcgc
tttgcggctcttgatgcagtaatgaatcttgattgggatgcacgtttccgtcatgcagat
tgggactttaaacccgtttctgaaattggacgtccctttactgaagccgagcaacaaatt
atggaaattgatgcccgcattaaaggttctgtaaaatttgttgaagtaccaggtggtaac
attgctcttttaaccgcaggtggtggcgcttcagtattttactccgatgctgtagttgct
cgtggtggcactattgcaaactatgcagaatattcgggtgatcctgcagattgggcggtt
gaggcacttaccgaaaccatttgccgcttaccaaacattaagcacattattgttggtgga
gctattgcaaacttcactgatgttagagcaacctttagtggtattatcaatggtttccgt
tcaagcaaagcaagaggctaccttgaaaatgtgaaaatttgggtacgtcgtggcggtcca
aacgaagcacaagggcttgctgctatgaaacagcttcaagaagagggcttcgacattcat
gtttatgatcgtagtatgccaatgaccgacattgttgatcttgcattgaattcataa

DBGET integrated database retrieval system