KEGG   Chlorobium chlorochromatii: Cag_0879Help
Entry
Cag_0879          CDS       T00290                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cch  Chlorobium chlorochromatii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cag_0879 (pfkA)
   01230 Biosynthesis of amino acids
    Cag_0879 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0879 (pfkA)
   00030 Pentose phosphate pathway
    Cag_0879 (pfkA)
   00051 Fructose and mannose metabolism
    Cag_0879 (pfkA)
   00052 Galactose metabolism
    Cag_0879 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Cag_0879 (pfkA)
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cag_0879 (pfkA)
Protein phosphatases and associated proteins [BR:cch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cag_0879 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1211927..1212979)
Genome map
AA seq 350 aa AA seqDB search
MLLEDTRSNTLKLTFGGFVNKKALEKIAVLTSGGDAPGMNAAIRAVTRAAISNKLKVVGI
RRGYQGMIEGDFINLKASDVSGILQLGGTMLKTARSAAFRTTEGRAQAHEQLSKAAIDAV
VVIGGDGSFHGALMMSHEYNIPFVGIPATIDNDMYGTDYTIGYETALNTVVEAVDKIRET
ARSHGRVFFVEVMGHEAGMIALNSSIACGAEVVVIPELHNRQYDELHKFLCKGYKKKESS
GIVIVAEGEETGGALKIAEQVRKEHPEIDVRVSILGHIQRGGSPAAKDRINATRMGAAAI
EALLDDQKSVMIGLANDQIVRVPFNKAVKTNRTISHDLLEMQRLMNMWCC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttggaggacactcgtagcaacacattaaaactaacatttggcggttttgtgaat
aaaaaagcattagaaaaaatagcggtattaacctcaggtggcgatgcgccaggtatgaat
gccgctattcgtgcggttactcgcgcagcaattagcaataaattgaaagttgtaggtatt
cgtcgcggctatcaaggaatgatagagggtgattttattaaccttaaagcctccgatgtt
agcggtattctgcaacttggtggcaccatgcttaaaactgcccgtagcgcggcatttcgc
acaacggaagggcgagcacaagcacacgagcaattaagcaaagccgcaattgatgcagtt
gtagttattggtggcgatggttcatttcatggcgcattaatgatgtcgcatgaatataat
atcccgtttgtaggtattcccgccaccattgataacgatatgtatggcaccgattacact
attggctacgaaacagcgcttaatacagtagttgaagccgttgataaaattagagaaact
gcccgctcacacgggcgtgttttttttgttgaagtaatggggcatgaagctggtatgatt
gctctcaatagtagcatagcgtgtggtgctgaagtggttgttattcccgaattacacaac
cgtcaatatgatgagttacataaatttttatgcaaaggatataaaaagaaagagagtagt
ggtattgttattgttgcagaaggcgaagaaacaggaggtgctcttaagattgccgaacag
gtacgtaaagagcatcccgaaatagatgttcgcgtttcaattcttgggcacattcagcgt
ggtggcagcccagccgcaaaagatcgcattaatgcaacgcgaatgggggcagccgcaatt
gaagcgctgcttgatgatcaaaaaagcgtgatgattggtttagctaacgatcaaattgtt
cgcgttccttttaataaagcggttaaaacaaatcgcaccattagccatgatttgttggaa
atgcaacgattgatgaatatgtggtgctgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system