KEGG   Chlorobium chlorochromatii: Cag_0879Help
Entry
Cag_0879          CDS       T00290                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00010  Glycolysis / Gluconeogenesis
cch00030  Pentose phosphate pathway
cch00051  Fructose and mannose metabolism
cch00052  Galactose metabolism
cch00680  Methane metabolism
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
cch01120  Microbial metabolism in diverse environments
cch01130  Biosynthesis of antibiotics
cch01200  Carbon metabolism
cch01230  Biosynthesis of amino acids
cch03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_0879
   00030 Pentose phosphate pathway
    Cag_0879
   00051 Fructose and mannose metabolism
    Cag_0879
   00052 Galactose metabolism
    Cag_0879
  Energy metabolism
   00680 Methane metabolism
    Cag_0879
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cag_0879
Enzymes [BR:cch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cag_0879
Protein phosphatases and associated proteins [BR:cch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cag_0879
Messenger RNA biogenesis [BR:cch03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cag_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat AIRC Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABB28144
JGI: Cag0879
UniProt: Q3AS81
Position
complement(1211927..1212979)
Genome map
AA seq 350 aa AA seqDB search
MLLEDTRSNTLKLTFGGFVNKKALEKIAVLTSGGDAPGMNAAIRAVTRAAISNKLKVVGI
RRGYQGMIEGDFINLKASDVSGILQLGGTMLKTARSAAFRTTEGRAQAHEQLSKAAIDAV
VVIGGDGSFHGALMMSHEYNIPFVGIPATIDNDMYGTDYTIGYETALNTVVEAVDKIRET
ARSHGRVFFVEVMGHEAGMIALNSSIACGAEVVVIPELHNRQYDELHKFLCKGYKKKESS
GIVIVAEGEETGGALKIAEQVRKEHPEIDVRVSILGHIQRGGSPAAKDRINATRMGAAAI
EALLDDQKSVMIGLANDQIVRVPFNKAVKTNRTISHDLLEMQRLMNMWCC
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttggaggacactcgtagcaacacattaaaactaacatttggcggttttgtgaat
aaaaaagcattagaaaaaatagcggtattaacctcaggtggcgatgcgccaggtatgaat
gccgctattcgtgcggttactcgcgcagcaattagcaataaattgaaagttgtaggtatt
cgtcgcggctatcaaggaatgatagagggtgattttattaaccttaaagcctccgatgtt
agcggtattctgcaacttggtggcaccatgcttaaaactgcccgtagcgcggcatttcgc
acaacggaagggcgagcacaagcacacgagcaattaagcaaagccgcaattgatgcagtt
gtagttattggtggcgatggttcatttcatggcgcattaatgatgtcgcatgaatataat
atcccgtttgtaggtattcccgccaccattgataacgatatgtatggcaccgattacact
attggctacgaaacagcgcttaatacagtagttgaagccgttgataaaattagagaaact
gcccgctcacacgggcgtgttttttttgttgaagtaatggggcatgaagctggtatgatt
gctctcaatagtagcatagcgtgtggtgctgaagtggttgttattcccgaattacacaac
cgtcaatatgatgagttacataaatttttatgcaaaggatataaaaagaaagagagtagt
ggtattgttattgttgcagaaggcgaagaaacaggaggtgctcttaagattgccgaacag
gtacgtaaagagcatcccgaaatagatgttcgcgtttcaattcttgggcacattcagcgt
ggtggcagcccagccgcaaaagatcgcattaatgcaacgcgaatgggggcagccgcaatt
gaagcgctgcttgatgatcaaaaaagcgtgatgattggtttagctaacgatcaaattgtt
cgcgttccttttaataaagcggttaaaacaaatcgcaccattagccatgatttgttggaa
atgcaacgattgatgaatatgtggtgctgttaa

DBGET integrated database retrieval system